
Halogénures organiques
Dans cette catégorie, vous trouverez des molécules organiques contenant un ou plusieurs atomes d'halogène dans leur structure. Ces halogénures organiques incluent des composés bromés, iodés, chlorés et des halogénures cycliques. Les halogénures organiques sont largement utilisés en synthèse organique, en pharmaceutique, en agrochimie et en science des matériaux en raison de leur réactivité et de leur capacité à subir une variété de transformations chimiques. Chez CymitQuimica, nous offrons une sélection complète d'halogénures organiques de haute qualité pour soutenir vos applications de recherche et industrielles, garantissant une performance fiable et efficace dans vos projets synthétiques et analytiques.
Sous-catégories appartenant à la catégorie "Halogénures organiques"
20437 produits trouvés pour "Halogénures organiques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Bis-ACV trifluoroacetate salt
CAS :<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>Formule :C28H48N6O12S2Degré de pureté :Min. 95%Masse moléculaire :724.85 g/mol2-Chloropyridine-4-boronic acid
CAS :<p>2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.</p>Formule :C5H5BClNO2Degré de pureté :Min. 95%Masse moléculaire :157.36 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond)
CAS :<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-Val-Cys-p-chloro-Phe-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C54H66Cl2N12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,146.22 g/molMethylamine hydrochloride
CAS :Produit contrôlé<p>Methylamine hydrochloride is a biologically active chemical that can be used to treat eye disorders. It is a p-nitrophenyl phosphate substrate and its optimum concentration in the reaction solution is 0.5 mg/mL. The compound reacts with methylamine, which is produced by the hydrolysis of peptide hormones in the human body, to form a bicyclic heterocycle. The bicyclic heterocycle reacts with hydrogen fluoride in the model system to produce an analytical method for determining plasma mass spectrometry. Methylamine hydrochloride has been shown to inhibit biological activity at high concentrations and stimulate it at low concentrations.</p>Formule :CH6ClNCouleur et forme :White PowderMasse moléculaire :67.52 g/mol5-Bromo-2-fluorobenzoic acid
CAS :<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>Formule :C7H4BrFO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :219.01 g/molCalcium chloride dihydrate
CAS :<p>Calcium chloride dihydrate is a chemical compound that is used in the preparation of buffers, as well as in polymer synthesis and analytical chemistry. It is also used in the treatment of low blood calcium levels, which may occur from chronic kidney failure, malnutrition or malabsorption. Calcium chloride dihydrate has been shown to inhibit the proliferation of various cancer cells, including prostate cancer cells. This inhibition has been shown to be due to its ability to significantly cytotoxic effects on these cells. The cytotoxicity was found to be due to lysosomal membrane permeabilization and Ca2+ influx into the cell leading to apoptosis induction.</p>Formule :CaCl2•(H2O)2Degré de pureté :Min. 95%Couleur et forme :White Clear LiquidMasse moléculaire :147.01 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt
CAS :<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C47H86N14O13SDegré de pureté :Min. 95%Masse moléculaire :1,087.34 g/mol3-Fluoro-4-nitrobenzoic acid
CAS :<p>3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.</p>Formule :C7H4FNO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :185.11 g/molBombesin trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C71H110N24O18SDegré de pureté :Min. 95%Masse moléculaire :1,619.85 g/molLHRH (free acid) trifluoroacetate salt
CAS :<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>Formule :C55H74N16O14Degré de pureté :Min. 95%Masse moléculaire :1,183.28 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C185H270N48O51S2Degré de pureté :Min. 95%Masse moléculaire :4,046.55 g/molH-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Angiotensin II trifluoroacetate salt
CAS :<p>Angiotensin II is a peptide hormone that may act as a neurotransmitter or neuromodulator. It is one of the most important vasoconstrictor and aldosterone-secreting hormones produced by the renin-angiotensin system in mammals. Angiotensin II has been shown to stimulate cardiac contractility, increase vascular resistance, and regulate blood pressure. The effect of Angiotensin II on cardiac contractility is mediated through its binding to a response element in the promoter region of genes encoding for Ca2+ channels. This binding leads to increased Ca2+ influx into cardiac cells and increased myofibrillar Ca2+ sensitivity. Angiotensin II also activates reactive oxygen species (ROS) production, which causes injury to the renal tubular epithelium and induces tubulointerstitial injury in rats with diabetes. It also stimulates squamous cell carcinoma growth by inducing reactive oxygen species (ROS) production and activating signal trans</p>Formule :C50H71N13O12·xC2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,046.18 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C66H81N15O19Degré de pureté :Min. 95%Masse moléculaire :1,388.44 g/molα-Helical CRF (12-41) trifluoroacetate salt
CAS :<p>Please enquire for more information about Alpha-Helical CRF (12-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C152H251N43O47S2Degré de pureté :Min. 95%Masse moléculaire :3,497.01 g/mol3-Chloro-2-nitrobenzyl alcohol
CAS :<p>3-Chloro-2-nitrobenzyl alcohol is a chemical compound that has a molecular formula of C6H5ClNO2. This substance was synthesized by the reaction of 3-chloro-2-nitrobenzyl chloride with sodium hydroxide in methanol. The optimized geometry and vibrational frequencies were calculated using density functional theory (DFT) and theory of Raman scattering. The IR spectra were measured with Fourier transform infrared (FTIR) spectroscopy, which showed that the compound has a strong absorption in the region from 2,600 to 2,800 cm−1.</p>Formule :C7H6ClNO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :187.58 g/mol2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol
CAS :<p>2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol is a chemical that is used for the detection of hydrochloric acid in water vapor. It reacts with zirconium oxide, which generates a red fluorescing complex. The reaction can be detected by using a fluorescence spectrometer with a test sample. 2-(5-Bromo-2-pyridylazo)-5-(diethylamino)phenol is also used to detect the presence of nitrogen atoms and sodium citrate in samples by reacting with them. This chemical reacts with an acid complex to form stable complexes. The analytical method is based on measuring the redox potential of this reaction. The flow system of this technique allows for dehydration of dehydroascorbic acid (DHA).</p>Formule :C15H17BrN4ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :349.23 g/molH-Met-Cys-Glu-Lys-OH trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H35N5O7S2Degré de pureté :Min. 95%Masse moléculaire :509.64 g/molFITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C131H191N37O25S2Degré de pureté :Min. 95%Masse moléculaire :2,748.28 g/mol4-Chloro-3-nitrobenzenesulfonamide
CAS :<p>4-Chloro-3-nitrobenzenesulfonamide is a fluorogenic probe that can be used in the diagnosis of cancer. It inhibits the activity of MCL-1, which is an antiapoptotic protein. The skeleton of 4-Chloro-3-nitrobenzenesulfonamide has been shown to have carbonic and fluorescence properties. This chemical compound is also metabolized by azobenzene to form a fluorescent derivative that can be used for optical imaging in vivo.</p>Formule :C6H5ClN2O4SDegré de pureté :Min. 95%Masse moléculaire :236.63 g/mol3-(Difluoromethoxy)nitrobenzene
CAS :<p>Please enquire for more information about 3-(Difluoromethoxy)nitrobenzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H5F2NO3Degré de pureté :Min. 95%Masse moléculaire :189.12 g/molDiphenyliodonium chloride
CAS :<p>Diphenyliodonium chloride is a synthetic chemical that binds to DNA and inhibits the synthesis of proteins. It also has been shown to inhibit the growth of Gram-positive bacteria, including Methicillin-resistant Staphylococcus aureus (MRSA) and Streptococcus pneumoniae, but not Gram-negative bacteria such as Escherichia coli or Pseudomonas aeruginosa. Diphenyliodonium chloride is used in a variety of ways, including as an antimicrobial agent for the prevention of microbial contamination in pharmaceuticals and cosmetics.</p>Formule :C12H10ClIDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :316.56 g/molAlarin (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C119H199N45O35Degré de pureté :Min. 95%Masse moléculaire :2,820.14 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C157H252N44O43SDegré de pureté :Min. 95%Masse moléculaire :3,476.02 g/mol(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C142H240N44O38Degré de pureté :Min. 95%Masse moléculaire :3,171.7 g/molH-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt
CAS :<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>Formule :C26H42N8O8Degré de pureté :Min. 95%Masse moléculaire :594.66 g/mol(S)-3-Amino-3-(4-chlorophenyl)-propan-1-ol
CAS :<p>Please enquire for more information about (S)-3-Amino-3-(4-chlorophenyl)-propan-1-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H12ClNODegré de pureté :Min. 95%Masse moléculaire :185.65 g/molH-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution)
<p>Please enquire for more information about H-Pro-2-chlorotrityl resin (200-400 mesh) (High Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%5-Fluoro-2-nitroanisole
CAS :<p>5-Fluoro-2-nitroanisole is an aminophenol that has potent inhibitory activity against lung cancer cells. This agent inhibits the growth of cancer cells by methylating the epidermal growth factor receptor (EGFR) and preventing its activation. 5-Fluoro-2-nitroanisole also inhibits the production of epidermal growth factor, which is a potent mitogen for skin cells. In vitro cytotoxic activity was observed when this compound was combined with heat or ultraviolet light.</p>Formule :C7H6FNO3Degré de pureté :Min. 95%Couleur et forme :Light (Or Pale) Yellow To Tan To Grey SolidMasse moléculaire :171.13 g/molCytochrome C (88-104) (domestic pigeon) trifluoroacetate salt
CAS :<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C84H144N24O25Degré de pureté :Min. 95%Masse moléculaire :1,890.19 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS :<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C56H60N10O15S2Degré de pureté :Min. 95%Masse moléculaire :1,177.27 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/molAmyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (1-42) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C203H311N55O60SDegré de pureté :Min. 95%Masse moléculaire :4,514.04 g/mol9,9-Dioctyl-7-dibromofluorene
CAS :<p>9,9-Dioctyl-7-dibromofluorene is a linear polymer with an ethylene diamine backbone. It is a synthetic material that can be used for devices such as solar cells. 9,9-Dioctyl-7-dibromofluorene has been shown to have efficient light emission properties and high optical absorption in the visible region of the electromagnetic spectrum. The device efficiency of this material has been shown to be improved by substituent effects and reaction time.</p>Formule :C29H40Br2Degré de pureté :Min. 95%Masse moléculaire :548.44 g/molH-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt
CAS :<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H32N8O9Degré de pureté :Min. 95%Masse moléculaire :504.5 g/molEndothelin-2 (human, canine) trifluoroacetate
CAS :<p>Trifluoroacetate salt</p>Formule :C115H160N26O32S4Degré de pureté :Min. 95%Masse moléculaire :2,546.92 g/mol5-Bromo-2-(trifluoromethoxy)benzaldehyde
CAS :<p>5-Bromo-2-(trifluoromethoxy)benzaldehyde is a chemical that is used as a reactant in organic chemistry. It can be used as a building block for the synthesis of complex compounds, or as an intermediate in the preparation of fine chemicals. 5-Bromo-2-(trifluoromethoxy)benzaldehyde is also useful in research and development. It has been used to synthesize pharmaceuticals, pesticides, and other organic compounds.</p>Formule :C8H4BrF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :269.02 g/mol2,6-Dichloro-5-fluoronicotinic acid
CAS :<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>Formule :C6H2Cl2FNO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :209.99 g/mol4-Bromo-6-chloropyridazin-3(2H)-one
CAS :<p>4-Bromo-6-chloropyridazin-3(2H)-one is a glycosylation inhibitor and nucleoside analog that can be used in the treatment of cancer. It inhibits the synthesis of deoxyribonucleotides from ribonucleotides by binding to the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxynucleotides. 4-Bromo-6-chloropyridazin-3(2H)-one has been shown to inhibit glycosylation in rat liver cells. This drug also inhibits acetone and glycosidation, which are reactions that produce glucose from amino acids or carbohydrates. The crystallization process is also inhibited by this drug because it prevents the formation of nucleoside crystals, which are involved in DNA replication and cell division.</p>Formule :C4H2BrClN2ODegré de pureté :Min. 95%Masse moléculaire :209.43 g/molH-2,5-Diiodo-His-OH·HCl
CAS :<p>Please enquire for more information about H-2,5-Diiodo-His-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C6H7I2N3O2·HClDegré de pureté :Min. 95%Masse moléculaire :443.41 g/mol2-Bromo-6-methylpyridine-3-carboxaldehyde
CAS :<p>2-Bromo-6-methylpyridine-3-carboxaldehyde (BMPCA) is a pharmacological agent that belongs to the group of antagonists. It has been shown to be a potent antagonist at the NMDA receptor and may be used for treating neuropathic pain. BMPCA also has been shown to have competitive inhibition at the naphthyridine receptor, which may allow it to act as an antagonist or an agonist depending on its binding site. The regioisomeric analogs of BMPCA are 2-(2,5-dichloropyridyl)-6-methylpyridine-3-carboxaldehyde and 2-(2,5-dimethylpyridyl)-6-methylpyridine-3-carboxaldehyde. These analogs have been shown to inhibit the growth of tumor cells in vitro and in vivo.</p>Formule :C7H6BrNODegré de pureté :Min. 95%Masse moléculaire :200.03 g/molMaxadilan trifluoroacetate salt
CAS :<p>Maxadilan trifluoroacetate salt is a low-potency drug that binds to the GABA receptor and affects the central nervous system. Maxadilan trifluoroacetate salt is structurally related to leishmaniasis, an infectious disease caused by protozoa of the genus Leishmania. Maxadilan trifluoroacetate salt has been shown to prevent the development of autoimmune diseases in mice, including systemic lupus erythematosus, experimental autoimmune encephalomyelitis, and collagen-induced arthritis. Maxadilan trifluoroacetate salt has also been shown to be effective against cutaneous lesions in mice infected with Leishmania major. The mechanism of action is not yet known but may be due to its ability to influence mitochondrial membrane potential or fatty acid metabolism.</p>Formule :C291H466N86O94S6Degré de pureté :Min. 95%Masse moléculaire :6,865.73 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%3-Bromobenzyl alcohol
CAS :<p>3-Bromobenzyl alcohol (3BA) is a potent inhibitor of farnesyl diphosphate synthase, which is an enzyme that catalyzes the conversion of dimethylallyl diphosphate and 5,6,7,8-tetrahydrofolic acid to farnesyl diphosphate. It has been shown to be effective in the treatment of cancer. 3BA blocks the synthesis of farnesyl diphosphate and protein geranylgeranylation. It also inhibits tumor growth by inducing apoptosis. The efficacy of 3BA is limited by its toxicity at high concentrations. 3BA has also been found to inhibit nitrous oxide production in mice and rats.</p>Formule :C7H7BrODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :187.03 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS :<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C165H252N44O48S•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :3,652.1 g/molH-D-Ser-OBzl hydrochloride salt
CAS :<p>H-D-Ser-OBzl hydrochloride salt is a monoclonal antibody that inhibits the activity of an enzyme called fatty acid synthase (FAS). It also binds to glycoconjugates, which are molecules that are involved in the inflammatory response. H-D-Ser-OBzl hydrochloride salt is used to treat various types of inflammatory diseases, such as arthritis and Crohn's disease. H-D-Ser-OBzl hydrochloride salt has been shown to inhibit tumor cell growth by binding to an enzyme called fatty acid synthase. H-D-Ser-OBzl hydrochloride salt also inhibits the production of inflammatory mediators, such as prostaglandins, leukotrienes and thromboxanes. The antiinflammatory effect of this drug may be due to its ability to inhibit prostaglandin synthesis.</p>Formule :C10H13NO3Degré de pureté :Min. 95%Masse moléculaire :195.22 g/mol(Trifluoromethylthio) Silver(I)
CAS :<p>(Trifluoromethylthio) silver(I) is an efficient method for the synthesis of chiral, functionalized organosulfur compounds. It is prepared by the trifluoromethylthiolation of aryl acetonitriles in the presence of persulfate and a radical coupling agent. The reaction time can be adjusted to suit the desired product, with shorter times producing more complex molecules. This compound can be used as a nucleophile in organic reactions, including sulfide activation reactions.</p>Formule :CHAgF3SDegré de pureté :Min. 95%Masse moléculaire :209.95 g/mol(D-Trp8)-Somatostatin-14 trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C76H104N18O19S2Degré de pureté :Min. 95%Masse moléculaire :1,637.88 g/mol5-Chloro-2-nitrodiphenylamine
CAS :<p>5-Chloro-2-nitrodiphenylamine is a synthetic dyestuff that belongs to the class of acridones. It can be used as an anti-epileptic drug, although it has not been approved for this use in any country. 5-Chloro-2-nitrodiphenylamine is manufactured by reacting a 6-carboxylic acid with an organic solvent and ammonolysis. This chemical is also known as 6'-chloroacridone and is used in the production of dyes and pigments. The manufacturing process produces impurities such as chloride, which must be removed by evaporation. Nitro groups are introduced during the manufacturing process to improve the dye's stability and color fastness under light exposure.</p>Formule :C12H9ClN2O2Degré de pureté :Min. 95%Couleur et forme :Orange To Red SolidMasse moléculaire :248.66 g/molent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt
CAS :<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C79H119N15O13Degré de pureté :Min. 95%Masse moléculaire :1,486.88 g/molCholesteryl Bromide from Beef Fat
CAS :Produit contrôlé<p>Cholesteryl Bromide from Beef Fat is a fatty acid that is extracted from beef fat. It is used in the production of polymeric matrices for the treatment of radiation burns, skin ulcers, and pressure sores. Cholesteryl Bromide from Beef Fat has been shown to be effective in inhibiting the growth of skin cells when applied topically. It also has been shown to inhibit the growth of cancer cells in vitro and inhibit tumor formation in mice. This fatty acid also has been found to have a role as a biological function by stimulating cell proliferation and being involved in lipid metabolism. It also is an aliphatic hydrocarbon with a group p2 structure that can be converted into cholesteryl erucate through hydrochloric acid.</p>Formule :C27H45BrDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :449.55 g/mol3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid
CAS :<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>Formule :C12H12O4F2Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :258.22 g/mol3,3'-Diiodo-L-thyronine
CAS :<p>3,3'-Diiodo-L-thyronine (T2) is a thyroid hormone that binds to the DNA response element in the promoter region of its target genes. It has been shown to decrease the transcription of genes encoding for proteins involved in energy metabolism and thus may play a role in weight loss. T2 also inhibits the production of hydrochloric acid by human gastric cells, which may lead to a reduction of stomach acidity. T2 is detectable in serum within 3 hours following ingestion and can be quantified using high performance liquid chromatography with electrochemical detection. The matrix effect is a phenomenon that occurs when samples are analyzed using different analytical methods and this must be taken into account when interpreting results. T2 has been shown to have pharmacological effects on experimental animals, including the stimulation of liver cell growth and an increase in metabolic rate.</p>Formule :C15H13I2NO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :525.08 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C77H116N20O19SDegré de pureté :Min. 95%Masse moléculaire :1,657.93 g/molMethyl 3-chloro-4-fluorobenzoate
CAS :<p>Methyl 3-chloro-4-fluorobenzoate is a white crystalline solid with a melting point of 61°C. It is soluble in ethyl acetate, ether, and chloroform. Methyl 3-chloro-4-fluorobenzoate is used as a reagent in the synthesis of polymers, pharmaceuticals, and pesticides. It has been shown to be useful as a building block for the synthesis of complex compounds such as heterocycles and polymers. Methyl 3-chloro-4-fluorobenzoate is also used as an intermediate in the production of other chemicals such as pharmaceuticals, catalysts, and herbicides.</p>Formule :C8H6ClFO2Degré de pureté :Min. 95%Masse moléculaire :188.58 g/mol5-Bromoquinolin-6-amine
CAS :<p>Please enquire for more information about 5-Bromoquinolin-6-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H7BrN2Degré de pureté :Min. 95%Masse moléculaire :223.07 g/molZ-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt
CAS :<p>Please enquire for more information about Z-Arg-p-nitrobenzyl ester mixture of hydrochloride and hydrobromide salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H25N5O6Degré de pureté :Min. 95%Masse moléculaire :443.45 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS :<p>Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C6H4BF4NO2Degré de pureté :Min. 95%Masse moléculaire :208.91 g/molω-Agatoxin IVa trifluoroacetate
CAS :<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>Formule :C217H360N68O60S10Degré de pureté :Min. 95%Masse moléculaire :5,202.26 g/molMca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Pro-Leu-Ala-Nva-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C49H68N14O15Degré de pureté :Min. 95%Masse moléculaire :1,093.15 g/mol6-Bromonaphthalen-1-ol
CAS :<p>6-Bromonaphthalen-1-ol is a compound that has shown antimicrobial and antifungal activity. It is the most potent of the naphthoxazines tested to date, with an MIC of 0.04 µg/ml against Escherichia coli. 6-Bromonaphthalen-1-ol was synthesized by reacting 1,2,4-trihydroxybenzene with bromine gas in the presence of mercuric chloride catalyst. The compound was hydrolyzed for elemental analysis and found to be C7H4BrO. Elemental analysis yielded a weight percentage of 71% carbon, 13% hydrogen, 3% bromine, and 12% oxygen. The x-ray diffraction pattern showed peaks at 2θ values of 22.3° (100), 26.5° (101), 33.7° (102), 40° (104), 44° (105) and 62°</p>Formule :C10H7BrODegré de pureté :Min. 95%Masse moléculaire :223.07 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS :<p>Amide; Trifluoroacetate salt</p>Formule :C64H109N19O24SDegré de pureté :Min. 95%Masse moléculaire :1,560.73 g/mol2,4'-Dichlorochalcone
CAS :<p>2',4'-Dichlorochalcone is a chalcone that has been stabilized by the attachment of two chlorine atoms. The crystal structure of 2',4'-Dichlorochalcone contains intermolecular hydrogen bonds and dihedral angles. The molecule also has intramolecular hydrogen bonds and dihedral angles, which are formed by the propenone and benzene groups. 2',4'-Dichlorochalcone can be used to create new drugs for antifungal, anti-inflammatory, or anti-cancer treatments.</p>Formule :C15H10Cl2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :277.14 g/molH-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%4-Fluoro-4'-hydroxybiphenyl
CAS :<p>4-Fluoro-4'-hydroxybiphenyl is a reactive chemical that belongs to the group of halogenated hydrocarbons. It is used in the synthesis of medicines and has been shown to have high viscosity. 4-Fluoro-4'-hydroxybiphenyl can be synthesized by reacting with chloride in the liquid phase, resulting in a viscous liquid. This compound has also been used as an intermediate for the synthesis of other compounds. 4-Fluoro-4'-hydroxybiphenyl is used as a ligand for metal complexes and reacts with phosphine to form a phosphine oxide, which is then converted into a crystal compound. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>Formule :C12H9FODegré de pureté :Min. 95%Masse moléculaire :188.2 g/mol3-Bromopyridazine
CAS :<p>3-Bromopyridazine is a dechlorinated derivative of pyridazine that has been used as an agrochemical. 3-Bromopyridazine can be synthesized by aminocarbonylation at the 3-position, which is a nucleophilic substitution reaction. It has been shown to yield high yields and to react with nucleophiles such as chlorine or heterocycles such as cinnoline. 3-Bromopyridazine can also be obtained by cross coupling of 2-bromoacetophenone with benzaldehyde and pyridine in the presence of copper. The resulting product is then reacted with sodium nitrite in hydrochloric acid to produce 3-bromopyridazine. This compound may have potential use as a chemical intermediate for other compounds, due to its chemical stability and its ability to undergo cross coupling reactions.</p>Formule :C4H3BrN2Degré de pureté :Min. 95%Masse moléculaire :158.98 g/molKisspeptin-13 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C78H107N21O18Degré de pureté :Min. 95%Masse moléculaire :1,626.81 g/molChloroformamidineHydrochloride
CAS :<p>ChloroformamidineHydrochloride is an inorganic acid that has a nitrogen atom and a chlorine atom. It is a polymer that is used in the film-forming industry. ChloroformamidineHydrochloride has been shown to be toxicological studies, with tests involving the film forming properties of this molecule. It also has biological properties and can target enzymes such as toll-like receptors and streptococcus faecalis, which are present on the surface of cells. ChloroformamidineHydrochloride can be reacted with creatine to form a molecule called thymidylate, which is needed for DNA synthesis and repair.</p>Formule :CH4Cl2N2Degré de pureté :Min. 95%Masse moléculaire :114.96 g/mol6-Hydroxy-6-defluoro Ciprofloxacin hydrochloride
CAS :<p>Hydrochloride salt</p>Formule :ClC17H20N3O4Degré de pureté :Min. 95%Masse moléculaire :365.81 g/mol(Lys7)-Phalloidin trifluoroacetate
CAS :<p>Please enquire for more information about (Lys7)-Phalloidin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C35H49N9O9S•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :771.88 g/molSalusin-α (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Salusin-alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C114H192N40O30Degré de pureté :Min. 95%Masse moléculaire :2,603 g/mol5,7-Dichloro-8-hydroxyquinaldine
CAS :<p>5,7-Dichloro-8-hydroxyquinaldine is an antimicrobial agent that can be used to treat infections caused by Gram-negative bacteria. It has been shown to have a broad spectrum of activity against both aerobic and anaerobic bacteria. 5,7-Dichloro-8-hydroxyquinaldine is active against methicillin resistant Staphylococcus aureus (MRSA) and Enterococci species. The drug has been shown to be effective in treating tissue infections in women with menstrual blood flow due to its anti-inflammatory properties. This drug is not absorbed well into the body via oral administration and is not widely available outside of China.</p>Formule :C10H7Cl2NODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :228.07 g/mol(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C190H286N54O56Degré de pureté :Min. 95%Masse moléculaire :4,222.63 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%(D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-2-Nal 5,Cys6·11,Tyr7,D-Trp8,Val10, 2-Nal 12)-Somatostatin-14 (5-12) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C63H73N11O9S2Degré de pureté :Min. 95%Masse moléculaire :1,192.45 g/molLHRH II trifluoroacetate salt
CAS :<p>LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.</p>Formule :C60H69N17O13Degré de pureté :Min. 95%Masse moléculaire :1,236.3 g/molPropamocarbHydrochloride
CAS :<p>Propamocarb hydrochloride is a crystalline polymorph that has been found to be active against the bacterial strain. The mechanism of action is not yet known, but it may be due to inhibition of the enzyme carboxypeptidase A and/or an unknown biological function. Propamocarb hydrochloride has shown no significant toxicity in animal studies up to a dose of 2000 mg/kg. This compound has been studied as a potential treatment for tissue damage caused by inflammation and disease. In vitro experiments have shown that propamocarb hydrochloride is effective at inhibiting the growth of cancer cells in tissue culture, with high values (IC50) being seen at concentrations of 1-10 μM.</p>Formule :C9H21ClN2O2Degré de pureté :Min. 95%Masse moléculaire :224.73 g/molDL-Alanine ethyl ester hydrochloride
CAS :<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>Formule :C5H11NO2·HClDegré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :153.61 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C43H79N13O12S2Degré de pureté :Min. 95%Masse moléculaire :1,034.3 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C208H308N54O61SDegré de pureté :Min. 95%Masse moléculaire :4,573.06 g/molBoc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS :<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H32N4O4Degré de pureté :Min. 95%Masse moléculaire :344.45 g/mol2-Amino-1-phenylpropan-1-one hydrochloride
CAS :Produit contrôlé<p>2-Amino-1-phenylpropan-1-one hydrochloride is a chemical compound that can be used as an intermediate in the synthesis of ethyl formate. It is also a pharmaceutical intermediate, which is used to prepare triazine and alicyclic compounds. It has been shown to have potential use in the treatment of prostatic hypertrophy and heterocycle disorders. 2-Amino-1-phenylpropan-1-one hydrochloride has been found to be active in animals and humans and is not toxic to women or animals. This drug has shown no adverse effects on human health at doses up to 10 g/kg body weight.</p>Formule :C9H11NO•HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :185.65 g/mol2-Fluoro-6-methylbenzoic acid
CAS :<p>Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H7FO2Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :154.14 g/mol6-Bromo-1,4-benzodioxane
CAS :<p>6-Bromo-1,4-benzodioxane is an organometallic compound that is used as a ligand in asymmetric hydrogenation reactions. 6-Bromo-1,4-benzodioxane has been shown to catalyze the hydrogenation of 1,2-diphenylacetylene with a high degree of stereoselectivity. The dihedral angles and molecular modeling have been studied for the ligand and catalyst complexes. This prochiral ligand has also been used to mediate the asymmetric hydrogenation of biphenyls in multigram scale.</p>Formule :C8H7BrO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :215.04 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H297N55O56SDegré de pureté :Min. 95%Masse moléculaire :4,327.84 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS :<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H4BrF3O2Degré de pureté :Min. 95%Masse moléculaire :269.02 g/molAQEE-30 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C157H252N48O56Degré de pureté :Min. 95%Masse moléculaire :3,707.97 g/molGalanin-Like Peptide (porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C281H443N81O78Degré de pureté :Min. 95%Masse moléculaire :6,204.02 g/mol2,3-Dichloroanisole
CAS :<p>2,3-Dichloroanisole is a volatile organic compound that has been shown to be an attractant for termites. It is used as a pesticide and agrochemical. 2,3-Dichloroanisole is used as an insecticide against termites and other pests in agriculture. This chemical has been shown to inhibit the sodium channel of the nerve cell membrane, which leads to paralysis of insects. The mechanism of action for this compound is not well understood but it has been suggested that it may act by blocking the reorientation of the sodium ion channels. 2,3-Dichloroanisole can also be used as a metal salt in some thermodynamic reactions.</p>Formule :C7H6Cl2ODegré de pureté :Min. 97%Couleur et forme :PowderMasse moléculaire :177.03 g/mol5-Chloro-8-hydroxyquinoline
CAS :<p>5-Chloro-8-hydroxyquinoline (5-CQ) is a quinoline derivative that has been used as an anticancer agent. It binds to DNA and inhibits the synthesis of RNA and proteins, leading to cell death. 5-CQ has been shown to be cytotoxic against skin cells in vitro by inhibiting mitochondrial oxidative phosphorylation and decreasing the mitochondrial membrane potential. This compound also has genotoxic effects on cultured choroidal neovascularization cells through the inhibition of DNA synthesis.<br>5-CQ binds to DNA via hydrogen bonds with nitrogen atoms in the purine ring of nucleobases. The overall geometry is that of a distorted octahedron with two faces, each containing six nitrogens in square planar coordination geometry. The binding constants are low for purines but high for pyrimidines, which is why 5-CQ preferentially targets purine rich regions of the genome.</p>Formule :C9H6ClNODegré de pureté :Min. 95%Couleur et forme :Green To Grey SolidMasse moléculaire :179.6 g/molAmyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid Bri Protein Precursor277 (89-106) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C87H141N21O30SDegré de pureté :Min. 95%Masse moléculaire :1,993.24 g/mol2-Fluoroanisole
CAS :<p>2-Fluoroanisole is an organic compound that is used in organic synthesis as a chiral auxiliary. It has been shown to inhibit the growth of cancer cells by binding to nucleophilic sites on the cell and preventing the formation of new proteins. 2-fluoroanisole is synthesized through a two-step process that begins with the asymmetric synthesis of the desired chiral molecule using a chiral catalyst and deuterium isotope. The second step involves converting 2-fluoroanisole into its more stable form, dodecanedioic acid, by treating it with hydrochloric acid or trifluoroacetic acid. The structural analysis of this molecule revealed that it contains two nucleophilic substitutions, which are likely responsible for its inhibitory properties.</p>Formule :C7H7FODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :126.13 g/mol4-Methoxy-3-(trifluoromethyl)benzoic acid
CAS :<p>4-Methoxy-3-(trifluoromethyl)benzoic acid is a useful scaffold that can be used as a building block for the synthesis of complex compounds. It has been shown to react with various reagents and is a versatile building block that can be used in organic synthesis. 4-Methoxy-3-(trifluoromethyl)benzoic acid is a high quality chemical and has been classified as speciality chemicals. This product is also known by the CAS number 213598-09-5.</p>Formule :C9H7F3O3Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :220.15 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS :<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%3-(Trifluoromethyl)phenylacetic acid
CAS :<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>Formule :C9H7F3O2Degré de pureté :Min. 95%Masse moléculaire :204.15 g/mol8-Quinolinesulfonyl chloride
CAS :<p>8-Quinolinesulfonyl chloride (8QSC) is a quinoline derivative that has been shown to have anticancer activity. 8QSC binds to the receptor site of cells and inhibits the production of amines, which are important for cell growth and proliferation. It also binds to hydrogen bonds, which may be involved in the cytotoxicity observed in pancreatic cancer cells. 8QSC shows significant cytotoxicity against Panc-1 cells, but not against NIH 3T3 cells. This may be due to its ability to form supramolecular aggregates with copper ions and quinoline derivatives.</p>Degré de pureté :Min. 95%N-Methyl-N-phenylcarbamoyl chloride
CAS :<p>N-Methyl-N-phenylcarbamoyl chloride is a fluorinated compound that has been shown to be resistant to treatments with chlorides. It is used for kinetic studies of amines and other functional assays. Deuterium isotope effects have been observed in chloride ion binding experiments, which indicate that the molecule has a greater affinity for the chloride ion than does its non-deuterated counterpart.</p>Formule :C8H8ClNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :169.61 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C61H86N16O13Degré de pureté :Min. 95%Masse moléculaire :1,251.44 g/mol1-(2,4-Dichlorophenyl)-1H-pyrrole-2,5-dione
CAS :<p>Maleimide is a chemical compound with the molecular formula CH2=C(O)NHC(=O)CH2-CO2H. It is a reactive monomer that polymerizes in the presence of an initiator to form polymers. Maleimides are also used as cross-linking agents, and have been shown to be thermostable and stable at high temperatures. This particular maleimide is a colorless solid that has been shown to copolymerize with methyl methacrylate and other monomers to form thermally stable, hydrophobic polymers.</p>Formule :C10H5Cl2NO2Degré de pureté :Min. 95%Masse moléculaire :242.06 g/molAmyloid β-Protein (25-35) trifluoroacetate salt
CAS :<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Formule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molAcetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C150H246N44O38Degré de pureté :Min. 95%Masse moléculaire :3,273.83 g/molN-Methyl-L-trans-4-hydroxyproline hydrochloride
CAS :<p>N-Methyl-L-trans-4-hydroxyproline hydrochloride is a bioactive compound that is present in the leaves of Semecarpifolia. It has been found to have antioxidant and anti-inflammatory properties. The chemical structure of N-methyl-L-trans-4-hydroxyproline hydrochloride is cyclic, butanamide, hexane, ethanolic extracts, and semecarpifolia. The family Meliaceae includes species such as Eucalyptus, which produces the bioactive compound cineole. Solvents used in this process are hexane and ethanolic extracts.</p>Formule :C6H11NO3·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :181.62 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C51H79N17O13Degré de pureté :Min. 95%Masse moléculaire :1,138.28 g/mol1H,1H,2H,2H-Heptadecafluorodecyl iodide
CAS :Produit contrôlé<p>1H,1H,2H,2H-Heptadecafluorodecyl iodide is a volatile chemical that is used in the transport of various analytes. It can be used to detect alcohols and organic chemicals in the environment. 1H,1H,2H,2H-Heptadecafluorodecyl iodide has been sporadically found in the atmosphere of China.</p>Formule :C10H4F17IDegré de pureté :Min. 95%Masse moléculaire :574.02 g/molNeuromedin U-25 (porcine) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuromedin U-25 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C144H217N43O37Degré de pureté :Min. 95%Masse moléculaire :3,142.53 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C156H244N48O40S2Degré de pureté :Min. 95%Masse moléculaire :3,496.04 g/mol3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole
CAS :<p>Please enquire for more information about 3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H9F3N2Degré de pureté :Min. 95%Masse moléculaire :226.2 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C161H240N46O41S2Degré de pureté :Min. 95%Masse moléculaire :3,540.05 g/molBIM-23627 trifluoroacetate salt
CAS :<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C58H69ClN12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,161.83 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/molTetrabromophenol blue sodium salt
CAS :<p>Tetrabromophenol blue sodium salt is a dye that is used as an additive in the production of vinyl alcohol polymer films. Tetrabromophenol blue sodium salt can be used to measure albumin concentration and postexposure by adding phenyl groups to the molecule. The color of tetrabromophenol blue sodium salt changes upon exposure to radiation, which makes it useful for diagnostic purposes. It also has a hydrocarbon group that transforms into an insoluble form when exposed to evaporation, making it useful for titration methods. Tetrabromophenol blue sodium salt is relatively stable and labile in nature, making it susceptible to techniques such as pyrolysis, oxidation, or reduction.</p>Formule :C19H5Br8NaO5SDegré de pureté :Min. 95%Masse moléculaire :1,007.53 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS :<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formule :C75H110N24O16S2Degré de pureté :Min. 95%Masse moléculaire :1,667.96 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS :<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C122H203N37O32Degré de pureté :Min. 95%Masse moléculaire :2,700.15 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS :<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Formule :C84H119N27O28Degré de pureté :Min. 95%Masse moléculaire :1,955.01 g/molZ-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a small molecule that has been shown to induce apoptosis in cultured cells. It is a caspase-3 inhibitor, which prevents the activation of the caspase cascade and protects cells from oxidative injury. Low doses of Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone have been shown to induce apoptosis in cultured cells, with no significant cytotoxicity at high doses. The mechanism of action for this agent is not yet known, but it may promote mitochondrial membrane potential loss and neuronal death by binding to DNA, or induce cell death through a caspase-independent pathway.</p>Formule :C30H41FN4O12Degré de pureté :Min. 95%Masse moléculaire :668.66 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS :<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C15H19F2NO4Degré de pureté :Min. 95%Masse moléculaire :315.31 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C205H333N63O54SDegré de pureté :Min. 95%Masse moléculaire :4,576.3 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C189H295N55O51S2Degré de pureté :Min. 95%Masse moléculaire :4,217.84 g/mol2-Bromo-5-hydroxy-4-methoxybenzaldehyde
CAS :<p>2-Bromo-5-hydroxy-4-methoxybenzaldehyde is a death pathway inhibitor that has been shown to have radiosensitizing effects in vitro. It has also been found to inhibit the expression of matrix metalloproteinase (MMP) in human glioma cells and in a rat model of cerebral ischemia. This compound may be used as a potential chemotherapeutic agent for the treatment of cancer. 2-Bromo-5-hydroxy-4-methoxybenzaldehyde inhibits cell proliferation by inducing apoptosis, or programmed cell death, which may be due to its ability to suppress MMP activity.</p>Formule :C8H7BrO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :231.04 g/mol2-(3,4-Dichlorophenyl)ethanol
CAS :<p>2-(3,4-Dichlorophenyl)ethanol is a high quality reagent for the synthesis of complex compounds, useful as an intermediate in organic synthesis and as a building block for speciality chemicals. This chemical is also used as a research chemical in the synthesis of versatile building blocks. It can be used as a reaction component in various reactions such as Suzuki coupling, Negishi coupling, Heck reaction, and Sonogashira coupling.</p>Formule :C8H8Cl2ODegré de pureté :Min. 95%Masse moléculaire :191.05 g/mol3-Chlorophenyl acetic acid
CAS :<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Formule :C8H7ClO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :170.59 g/mol4-Chlorophenethyl alcohol
CAS :<p>4-Chlorophenethyl alcohol is a synthetic, primary alcohol. It can be synthesized by reacting 2,4-dichlorobenzoic acid with a Grignard reagent. The reaction produces 4-chlorophenethyl alcohol, which is insoluble in water and reacts with chloride to form chloroform. This procedure can be used to produce other chlorinated alcohols. 4-Chlorophenethyl alcohol has been shown to have acute toxicities that are similar to those of trifluoroacetic acid and it is believed that the toxicity is due to its ability to react with proteins and nucleic acids.</p>Formule :C8H9ClODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :156.61 g/mol3-Iodo-1H-pyrrolo[2,3-b]pyridine
CAS :<p>3-Iodo-1H-pyrrolo[2,3-b]pyridine (3IOP) is a molecule that has been shown to be cytotoxic against human ovarian carcinoma cells. It induces significant cytotoxicity in cancer cell lines and inhibits the proliferation of lung fibroblasts. 3IOP has been shown to activate cellular signaling pathways and cause multinuclear DNA damage.</p>Formule :C7H5IN2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :244.03 g/molAlarin (human) trifluoroacetate salt
CAS :<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formule :C127H205N43O35Degré de pureté :Min. 95%Masse moléculaire :2,894.26 g/mol3-Bromo-4-fluorophenol
CAS :<p>3-Bromo-4-fluorophenol is a synthetic, water soluble, and stable compound with a variety of applications. It yields white crystals that are soluble in water, acetone, ethanol, ether, benzene, chloroform, and carbon tetrachloride. 3-Bromo-4-fluorophenol has been shown to have a number of structural modifications that may be advantageous for therapeutic purposes. The most prominent modification is the methylation of the phenolic hydroxyl group (functionalisation). This modification prevents the drug from reacting with nucleophilic sites on proteins and other biological molecules. 3-Bromo-4-fluorophenol interacts with methyltransferase enzymes in cancer cells to inhibit their activity. These methyltransferase enzymes are involved in cellular proliferation and proliferation signalling pathways that may lead to cancer cell death.</p>Formule :C6H4BrFODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :191 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS :<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C9H9F2NO2·HClDegré de pureté :Min. 95%Masse moléculaire :237.63 g/molIron(III) trifluoromethanesulfonate
CAS :<p>Iron trifluoromethanesulfonate is an inorganic compound that is used as a catalyst in organic reactions. It is a salt of iron(III) and triflic acid, with the formula Fe(O)(CF). It has been shown to be a cocatalyst for benzofuran derivatives and can be used to synthesize methyl ketones, alkylation products, diarylmethanes, primary alcohols, and cleavage products. Iron trifluoromethanesulfonate can also be used as a control experiment to study reaction mechanisms.</p>Formule :C3F9FeO9S3Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :503.06 g/molNFAT Inhibitor trifluoroacetate salt
CAS :<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>Formule :C75H118N20O22SDegré de pureté :Min. 95%Masse moléculaire :1,683.93 g/mol2,4-Dichloro-5-methoxyaniline
CAS :<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>Formule :C7H7Cl2NODegré de pureté :Min. 95%Couleur et forme :White To Pink SolidMasse moléculaire :192.04 g/molAmyloid β-Protein (40-1) trifluoroacetate salt
CAS :<p>Trifluoroacetate salt</p>Formule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.81 g/mol8-Desmethoxy-8-fluoro moxifloxacin
CAS :<p>8-Desmethoxy-8-fluoro moxifloxacin is a photolytic drug that is used to treat bacterial infections. It has a high degree of antibacterial activity against methicillin-resistant staphylococcus aureus, including methicillin resistant strains of Staphylococcus epidermidis. 8-Desmethoxy-8-fluoro moxifloxacin hydrochloride is produced by the addition of hydrochloric acid to moxifloxacin, which is then purified by ion chromatography. The compound has been shown to have good stability in human plasma and urine. It also shows excellent recoveries in acetonitrile and quantification results in flow rates.</p>Formule :C20H21F2N3O3Degré de pureté :Min. 95%Masse moléculaire :389.4 g/molZ-Asp(OtBu)-bromomethylketone
CAS :<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C17H22BrNO5Degré de pureté :Min. 95%Masse moléculaire :400.26 g/molH-Ala-Ala-pNA hydrochloride salt
CAS :<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H16N4O4Degré de pureté :Min. 95%Masse moléculaire :280.28 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C133H229N45O37Degré de pureté :Min. 95%Masse moléculaire :3,050.52 g/molTyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt
CAS :<p>Please enquire for more information about Tyr-(D-Dab 4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C67H85N15O11Degré de pureté :Min. 95%Masse moléculaire :1,276.49 g/molHIV (gp120) Antigenic Peptide trifluoroacetate salt
CAS :<p>Please enquire for more information about HIV (gp120) Antigenic Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C117H211N41O31SDegré de pureté :Min. 95%Masse moléculaire :2,720.25 g/mol4-Amino-6-chloro-1,3-benzenedisulfonamide
CAS :<p>4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 Amino</p>Formule :C6H8ClN3O4S2Degré de pureté :Min. 95%Couleur et forme :White To Light Brown SolidMasse moléculaire :285.73 g/molBromofluoroacetic Acid
CAS :<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Formule :C2H2BrFO2Degré de pureté :Min. 95%Masse moléculaire :156.94 g/mol3-Trifluoromethyl phenylhydrazine hydrochloride
CAS :<p>3-Trifluoromethyl phenylhydrazine HCl is a fine chemical that can be used as a versatile building block in the synthesis of complex compounds. It has been shown to be a useful intermediate for the preparation of research chemicals, reaction components and speciality chemicals. 3-Trifluoromethyl phenylhydrazine HCl belongs to CAS No. 3107-33-3 and can be used as a reagent in organic synthesis. The compound is high quality with a purity of over 99%.</p>Formule :C7H8ClF3N2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :212.6 g/mol2-Chloro-6-methoxypyridine
CAS :<p>2-Chloro-6-methoxypyridine (2CMP) is a potent antagonist that binds to copper chloride, inhibiting its ability to activate aryl chlorides. This chemical has been shown to have anti-angiogenic effects in human cancer cells and can be used for the treatment of cancer. 2CMP has also been shown to be effective at blocking angiogenesis in mice with breast cancer. 2CMP is synthesized through an asymmetric synthesis process, which involves the use of a dipole and molecular docking analysis.</p>Formule :C6H6ClNODegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :143.57 g/molHepcidin-1 (mouse) trifluoroacetate salt
CAS :<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C111H169N31O35S8Degré de pureté :Min. 95%Masse moléculaire :2,754.25 g/molMethyl 2,3-diamino-5-bromobenzoate
CAS :<p>Please enquire for more information about Methyl 2,3-diamino-5-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H9BrN2O2Degré de pureté :Min. 95%Masse moléculaire :245.07 g/molBiotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C65H92N20O15SDegré de pureté :Min. 95%Masse moléculaire :1,425.62 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/mol(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C203H312N58O60SDegré de pureté :Min. 95%Masse moléculaire :4,557.07 g/molH-Lys-Thr-OH hydrochloride salt
CAS :<p>H-Lys-Thr-OH hydrochloride salt is a synthetic amino acid that has been used in the synthesis of a cyclic peptide. The synthesis was achieved by metathesis reactions, which involved the reaction of an acid chloride with a chiral amine to form an ester. H-Lys-Thr-OH hydrochloride salt has been shown to have high binding constants to its targets and can be used as a selective reagent for the synthesis of virus proteins. It is also able to bind to carboxylate groups, which are common in wild type viruses and gene products. This reagent also has cleavage products, which can be used for efficient method for synthesizing cyclic peptides.</p>Formule :C10H21N3O4Degré de pureté :Min. 95%Masse moléculaire :247.29 g/mol(D-Trp6)-LHR
<p>Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C83H115N25O17Degré de pureté :Min. 95%Masse moléculaire :1,734.96 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :<p>GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt</p>Formule :C186H275N51O59Degré de pureté :Min. 95%Masse moléculaire :4,169.48 g/molMca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C53H70N12O20Degré de pureté :Min. 95%Masse moléculaire :1,195.19 g/molBoc-Asp(OBzl)-chloromethylketone
CAS :<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formule :C17H22ClNO5Degré de pureté :Min. 95%Masse moléculaire :355.81 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C215H355N63O54SDegré de pureté :Min. 95%Masse moléculaire :4,718.58 g/molPseudin-2 trifluoroacetate salt
CAS :<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C122H202N36O32Degré de pureté :Min. 95%Masse moléculaire :2,685.13 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/molDermcidin-1L (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C210H359N57O71Degré de pureté :Min. 95%Masse moléculaire :4,818.44 g/mol[4,4'-Di-t-butyl-2,2'-bipyridine][bis[5-(t-butyl)-2-[4-(t-butyl)-2-pyridinyl-kN]phenyl-kC]iridium(III) hexafluorophosphate
CAS :<p>Please enquire for more information about [4,4'-Di-t-butyl-2,2'-bipyridine][bis[5-(t-butyl)-2-[4-(t-butyl)-2-pyridinyl-kN]phenyl-kC]iridium(III) hexafluorophosphate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C56H72F6IrN4PDegré de pureté :Min. 95%Masse moléculaire :1,138.38 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS :<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C66H88N14O14Degré de pureté :Min. 95%Masse moléculaire :1,301.49 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C52H72N14O12Degré de pureté :Min. 95%Masse moléculaire :1,085.22 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C50H78N14O19Degré de pureté :Min. 95%Masse moléculaire :1,179.24 g/mol1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole
CAS :<p>1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole is an organic compound that is used in the synthesis of carboxylic acid derivatives. It is a synthetic intermediate, which can be converted to other compounds by intramolecular hydrogen bonding. The efficiency of this method has been shown through a number of experiments. In nature, 1-methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole may be found as a hydrogen bond donor.</p>Formule :C7H5Cl3N2O3Degré de pureté :Min. 95%Masse moléculaire :271.48 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C184H277N51O56SDegré de pureté :Min. 95%Masse moléculaire :4,131.54 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS :<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>Formule :C23H34N6O9Degré de pureté :Min. 95%Masse moléculaire :538.55 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS :<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C63H113N22O25PSDegré de pureté :Min. 95%Masse moléculaire :1,641.74 g/mol1,2-Phenylene phosphorochloridite
CAS :<p>1,2-Phenylene phosphorochloridite is a chemical that is an intermediate for the synthesis of perfluorinated compounds. It has been used as a precursor for the synthesis of biodiesel. The proton NMR spectrum shows three resonances: one at δ 3.8 ppm (J = 6 Hz) corresponding to the protons on the aromatic ring, one at δ 4.7 ppm (J = 6 Hz) corresponding to the protons on the chloro group, and one at δ 7.6 ppm (J = 2 Hz) corresponding to the protons on the methylene chain. This chemical can be prepared by reacting trifluoroacetic acid with phenol in a preparative method with nucleophilic substitution or by dehydrating fatty alcohols with halides in a dehydration reaction.</p>Formule :C6H4ClO2PDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :174.52 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H300N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.88 g/mol8-Bromo-1-octanol
CAS :<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>Formule :C8H17BrODegré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :209.12 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C99H153N29O26S5Degré de pureté :Min. 95%Masse moléculaire :2,325.78 g/molCinnamoyl chloride
CAS :<p>Cinnamoyl chloride is an organic compound that can be synthesized in an asymmetric fashion. It is a metabolite of cinnamoyl-CoA and has been shown to have photochemical properties. Cinnamoyl chloride has also been shown to inhibit the growth of cervical cancer cells. This compound also has hydroxyl groups, which may act as an amide or receptor activator. Cinnamoyl chloride may be used for the treatment of infectious diseases such as chlamydia and mycoplasma.</p>Formule :C9H7ClODegré de pureté :Min. 95%Couleur et forme :Slightly Yellow PowderMasse moléculaire :166.6 g/mol(2-Chloropyridin-4-yl)methanamine
CAS :<p>2-Chloropyridin-4-yl)methanamine is a hydrogenated molecule that has been shown to inhibit the activity of certain cancer cells. It inhibits the expression of the enzyme molecules involved in the synthesis of DNA and RNA. 2-Chloropyridin-4-yl)methanamine also inhibits the hydrolysis of hydrogen chloride (HCl) to produce hydrogen (H2). This drug is used as an inhibitor for medicines that require acidic pH for absorption, such as HCl.</p>Formule :C6H7ClN2Degré de pureté :Min. 95%Masse moléculaire :142.59 g/mol4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa
CAS :<p>Please enquire for more information about 4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C16H19F2NO2Degré de pureté :Min. 95%Masse moléculaire :295.32 g/molN-(4-Chlorophenyl)-2-cyanoacetamide
CAS :<p>N-(4-Chlorophenyl)-2-cyanoacetamide is a pyridine compound that can be synthesized from chloroacetonitrile and acetamide. It has been shown to react with an active methylene group in benzene or pyridine to produce a heterocycle. This reaction is reversible and can be used as a preparative method for the synthesis of heterocycles. The 1,3-dipolar cycloaddition of N-(4-chlorophenyl)-2-cyanoacetamide with nitro groups in nitrobenzene produces the corresponding 2-nitropyridines, which are important intermediates in the synthesis of other heterocycles. N-(4-Chlorophenyl)-2-cyanoacetamide has been used as an efficient method for the preparation of nitrogen nucleophiles that are useful for catalysis.</p>Formule :C9H7ClN2ODegré de pureté :Min. 95%Masse moléculaire :194.62 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C167H260N40O54Degré de pureté :Min. 95%Masse moléculaire :3,692.09 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%pTH (1-37) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H316N58O54S2Degré de pureté :Min. 95%Masse moléculaire :4,401.09 g/mol3,5-Dichloro-4-methylpyridine
CAS :<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C6H5Cl2NDegré de pureté :Min. 95%Masse moléculaire :162.02 g/molH-Lys(Boc)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Boc)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%5-Bromoquinolin-8-amine
CAS :<p>5-Bromoquinolin-8-amine is a topoisomerase inhibitor that can be used as an antitumor agent. It has been shown to inhibit the growth of tumor cell lines and suppress the growth of colon carcinoma cells in rats and human colon carcinomas in mice. 5-Bromoquinolin-8-amine interacts with DNA, specifically inhibiting the formation of supercoiled DNA. This interaction may lead to the inhibition of tumor cell growth. 5-Bromoquinolin-8-amine also inhibits protein synthesis by interacting with proteins at the ribosomal level, leading to inhibited cell growth.</p>Formule :C9H7BrN2Degré de pureté :Min. 95%Masse moléculaire :223.07 g/molHemokinin 1 (human) trifluoroacetate salt
CAS :<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Formule :C54H84N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,185.4 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS :<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formule :C60H87N19O13Degré de pureté :Min. 95%Masse moléculaire :1,282.45 g/molGastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C214H324N58O63SDegré de pureté :Min. 95%Masse moléculaire :4,749.28 g/molHel 13-5 trifluoroacetate salt
CAS :Produit contrôlé<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>Formule :C113H204N24O19Degré de pureté :Min. 95%Masse moléculaire :2,202.98 g/mol5-(2-Bromo-acetyl)-2-hydroxy-benzaldehyde
CAS :<p>5-Bromo-2-hydroxybenzaldehyde is an organic compound with a chemical formula of CHBrO. It is a white solid that is soluble in water, ethanol, and acetone. The synthesis of 5-bromo-2-hydroxybenzaldehyde has been achieved by the acylation reaction of benzaldehyde with bromide ion. The selectivity for this reaction can be increased by using sodium borohydride as a reducing agent instead of lithium aluminum hydride. This method can be applied to the synthesis of salmeterol, which is used as a medicine in the treatment of asthma.</p>Formule :C9H7BrO3Degré de pureté :Min. 95%Masse moléculaire :243.05 g/mol4-Bromobutyl acetate
CAS :<p>4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.</p>Formule :C6H11BrO2Degré de pureté :Min. 95%Masse moléculaire :195.05 g/mol5-Chloro-2,1,3-benzothiadiazole
CAS :<p>5-Chloro-2,1,3-benzothiadiazole is a drug substance that belongs to the group of benzothiadiazoles. It is an organic solvent that is used in the chloromethylation of aromatic compounds and as a chromatographic reagent. 5-Chloro-2,1,3-benzothiadiazole has been used in research studies on the chlorination of acetonitrile and chloride. This drug is synthesized by reacting benzene with selenium dioxide and sodium hydroxide. 5-Chloro-2,1,3-benzothiadiazole can be produced by reacting benzene with nitromethane and oxalic acid or by heating phthalic anhydride with a solution of potassium hydroxide in acetonitrile. The liquid chromatography method is used to separate this drug from impurities such as monochloride,</p>Formule :C6H3ClN2SDegré de pureté :Min. 95%Masse moléculaire :170.62 g/mol6-Bromohexanoic acid methyl ester
CAS :<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>Formule :C7H13BrO2Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :209.08 g/mol(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone
CAS :<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>Degré de pureté :Min. 95%(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III)
CAS :<p>(1,10-Phenanthroline)tris[4,4,4-trifluoro-1-(2-thienyl)-1,3-butanedionato]europium(III) is a luminescent europium complex that is used in the development of microcapsules for fluorescence microscopy. The (1,10-phenanthroline) ligand is a chelate molecule that can be exchanged with other ligands to change the optical properties of the complex. The fluorescence microscope detects the emitted light at 488 nm and 514 nm wavelengths. The luminescent europium complex emits light when it binds to an organic molecule such as vinyl alcohol or water vapor. Ternary complexes are formed between the europium ion and two different ligands. Optical properties depend on the type of ligands present in these ternary complexes. This product has been shown to have chemical structures that are similar to those</p>Degré de pureté :Min. 95%Desmethyl sibutramine hydrochloride salt
CAS :<p>Desmethyl sibutramine hydrochloride salt is a pharmaceutical preparation that has been used in the treatment of depression and chronic pain. It is a synthetic drug that increases the level of dopamine in the brain by inhibiting its reuptake. In addition, it has been shown to be effective in the treatment of hyperactivity, diabetic neuropathy, and other amines. Desmethyl sibutramine hydrochloride salt also has an antidepressant effect by decreasing serotonin reuptake.</p>Formule :C16H25Cl2NDegré de pureté :Min. 95 Area-%Couleur et forme :White PowderMasse moléculaire :302.28 g/mol3-Fluoro-2-nitrobenzaldehyde
CAS :<p>3-Fluoro-2-nitrobenzaldehyde is a pyridine derivative that has been used in the synthesis of a number of important heterocyclic compounds. This compound can be prepared by reacting 3,4-dichloroaniline with nitrous acid and then hydrolyzing the resulting 3-chloroquinoline with hydrochloric acid. The reaction yields anilines and quinolines in regiospecifically, as well as formylation, cyclisation, and condensation products. It is also capable of aromatisation reactions with benzene to produce benzofuran derivatives.</p>Formule :C7H4FNO3Degré de pureté :Min. 95%Couleur et forme :Yellow PowderMasse moléculaire :169.11 g/mol3-Bromoimidazo[1,2-b]pyridazine
CAS :<p>3-Bromoimidazo[1,2-b]pyridazine (BIPM) is an analog of etoposide and has been shown to be a potent inhibitor of tyrosine kinases. BIPM selectively inhibits the activity of multikinase enzymes such as c-kit, PDGFRβ, and VEGFR2. In addition, BIPM has been shown to inhibit the proliferation of cancer cells by inducing apoptosis and cell cycle arrest in mcf-7 cells. This drug is not toxic to normal cells and shows a favorable safety profile when tested on animals.</p>Formule :C6H4BrN3Degré de pureté :Min. 95%Masse moléculaire :198.02 g/molOrexin A (17-33) trifluoroacetate salt
CAS :<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Formule :C79H125N23O22Degré de pureté :Min. 95%Masse moléculaire :1,748.98 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C184H273N51O57Degré de pureté :Min. 95%Masse moléculaire :4,111.45 g/mol(3,4,5-Trifluorophenyl)boronic acid
CAS :<p>The trifluorophenylboronic acid is a boronic acid that has been used in the synthesis of vitamin B12. This compound is often used as a catalyst for the Suzuki coupling reaction. It can also be used to synthesize amides and synthons. The trifluorophenylboronic acid is soluble in water, ethanol, and acetone. The pH of the solution depends on the type of base added. For example, when an amine is added to the solution, it increases to approximately 8-9. When a p-hydroxybenzoic acid is added to the solution, it decreases to approximately 2-3.</p>Formule :C6H4BF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :175.9 g/mol1-Acetyl-5-bromo-7-nitro-2,3-dihydro-1H-indole
CAS :<p>The 1-Acetyl-5-bromo-7-nitro-2,3-dihydro-1H-indole is a water soluble molecule. It has a molecular weight of 230.3 and a chemical formula of C8H6N2O2Br. The 1A5B7N1 is an aromatic heterocyclic compound that contains a ring with five carbon atoms, three nitrogens, and one oxygen. The 1A5B7N1 is also known as the 5 Bromo 7 Nitro 2,3 Dihydro 1 H Indole or the 5 Bromo 7 Nitro 2,3 Dihydroindole. This molecule has been seen to have bioactive properties in many different ways including photolysis efficiency and molecular orbital.</p>Formule :C10H9BrN2O3Degré de pureté :Min. 95%Masse moléculaire :285.09 g/mol5-Bromo-2-chlorobenzoyl chloride
CAS :<p>5-Bromo-2-chlorobenzoyl chloride is a chemical compound that is used as an intermediate for the production of compounds. It can be produced by the reaction of benzene with thionyl chloride in the presence of phenetole. The chemical reaction proceeds with high yield and utilizes a high concentration of benzene, which is a pollutant. The reaction yields a mixture of 5-bromo-2-chlorobenzoyl chloride and 2,4,6-trichlorobenzoyl chloride and utilizes an organic solvent such as formic acid or acetic acid to form 5-bromo-2,4,6-trichlorobenzoic acid in situ. 5-Bromo-2,4,6-trichlorobenzoic acid is then reacted with ammonia to produce 2-(5'-bromo)benzothiazole. This chemical compound has been used as a reagent</p>Formule :C7H3BrCl2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :253.91 g/molH-Lys(2-chloro-Z)-OBzl·HCl
CAS :<p>Please enquire for more information about H-Lys(2-chloro-Z)-OBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H25ClN2O4·HClDegré de pureté :Min. 95%Masse moléculaire :441.35 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS :<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formule :C86H104Cl2N18O13Degré de pureté :Min. 95%Masse moléculaire :1,668.76 g/mol(Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt
CAS :<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C54H76N14O11Degré de pureté :Min. 95%Masse moléculaire :1,097.27 g/mol4,5-Dibromobenzene-1,2-diamine
CAS :<p>Dibromobenzene-1,2-diamine (DBD) is a chemical compound that belongs to the group of diamines. It is used in cancer research as an anticancer drug, inhibiting the growth of cancer cells by blocking intracellular calcium levels. DBD has been shown to be effective against pancreatic cancer cells and human cancer cells. The photophysical properties of DBD are determined by its neutral structure and electron deficiency, which makes it a suitable candidate for use in radiation treatment.</p>Formule :C6H6Br2N2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :265.93 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Formule :C203H331N63O53SDegré de pureté :Min. 95%Masse moléculaire :4,534.26 g/molNefazodone hydrochloride
CAS :Produit contrôlé<p>Antagonist of 5-HT2A serotonin, α2-adrenergic and dopamine (D2) receptors</p>Formule :C25H33Cl2N5O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :506.47 g/mol
