Halogénures organiques
Dans cette catégorie, vous trouverez des molécules organiques contenant un ou plusieurs atomes d'halogène dans leur structure. Ces halogénures organiques incluent des composés bromés, iodés, chlorés et des halogénures cycliques. Les halogénures organiques sont largement utilisés en synthèse organique, en pharmaceutique, en agrochimie et en science des matériaux en raison de leur réactivité et de leur capacité à subir une variété de transformations chimiques. Chez CymitQuimica, nous offrons une sélection complète d'halogénures organiques de haute qualité pour soutenir vos applications de recherche et industrielles, garantissant une performance fiable et efficace dans vos projets synthétiques et analytiques.
Sous-catégories appartenant à la catégorie "Halogénures organiques"
20442 produits trouvés pour "Halogénures organiques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS :Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C58H69ClN12O9S2Degré de pureté :Min. 95%Masse moléculaire :1,177.83 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/mol4-Bromo-2-pyrrolecarboxaldehyde
CAS :4-Bromo-2-pyrrolecarboxaldehyde is a synthetic chemical that is used as an antifungal agent. It inhibits the growth of filamentous fungi by binding to their pyrrole rings and inhibiting the synthesis of proteins. 4-Bromo-2-pyrrolecarboxaldehyde has shown in vitro antifungal activity against isolates of Candida albicans, Aspergillus niger, and Fusarium oxysporum. This compound also has substitutions at positions 1 and 2 of the pyrrole ring, which are thought to be responsible for its inhibitory properties. 4-Bromo-2-pyrrolecarboxaldehyde is soluble in organic solvents such as acetone and chloroform.Formule :C5H4BrNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :174 g/molTrimeperidine hydrochloride
CAS :Produit contrôléTrimeperidine hydrochloride is a postoperative analgesic that is used in the treatment of nerve pain and other conditions. Trimeperidine hydrochloride belongs to the group of active substances. It has been shown to be effective as an epidural anesthesia for patients undergoing surgery and has a clinical effect on the nervous system, including pain, nausea, vomiting, and muscle spasms. Trimeperidine hydrochloride works by inhibiting the central nervous system (CNS) enzyme coagulation factor XIIa. It also prevents excessive release of neurotransmitters from nerve cells.br>br>Formule :C17H26ClNO2Degré de pureté :Min. 95%Masse moléculaire :311.85 g/molCytochrome C (88-104) (domestic pigeon) trifluoroacetate salt
CAS :Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C84H144N24O25Degré de pureté :Min. 95%Masse moléculaire :1,890.19 g/molH-beta-Chloro-Ala-NHOH hydrochloride salt
CAS :Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C3H7ClN2O2Degré de pureté :Min. 95%Masse moléculaire :138.55 g/molH-Asn-AMC trifluoroacetate salt
CAS :Please enquire for more information about H-Asn-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H15N3O4Degré de pureté :Min. 95%Masse moléculaire :289.29 g/molCyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt
CAS :Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.Formule :C36H58N10O8Degré de pureté :Min. 95%Masse moléculaire :758.91 g/molSodium 2,2,2-trifluoroethanolate
CAS :Sodium 2,2,2-trifluoroethanolate is a fluorinated alcohol. It is used as an animal health drug and has been shown to have a significant inhibitory effect on the growth of bacteria. The reaction intermediate for this compound is trifluoroacetic acid, which can be formed from sodium and hydrogen fluoride in the presence of ethylene glycol. This molecule also reacts with nitrosyl chloride to form a nitrogen-containing product. Sodium 2,2,2-trifluoroethanolate has been shown to be active against both Gram-positive and Gram-negative bacteria. The FTIR spectra for this compound shows that it has two sets of absorption bands at 3,200 cm−1 (due to C–H stretching) and 3,000 cm−1 (due to C=C stretching).Formule :C2H2F3NaODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :122.02 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C44H49FN4O14Degré de pureté :Min. 95%Masse moléculaire :876.88 g/molNalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide
CAS :Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.Formule :C12H15FN4O5Degré de pureté :Min. 95%Couleur et forme :Off-White To Yellow SolidMasse moléculaire :314.27 g/molAlpha-Conotoxin MI trifluoroacetate salt
CAS :Produit contrôléA component of Conus venom; antagonist of nicotinic acetylcholine receptorsFormule :C58H88N22O17S4Degré de pureté :Min. 95%Masse moléculaire :1,493.72 g/molAc-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt
CAS :Please enquire for more information about Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C41H66N6O11SDegré de pureté :Min. 95%Masse moléculaire :851.06 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C58H82N14O12Degré de pureté :Min. 95%Masse moléculaire :1,167.36 g/mol5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester
CAS :Please enquire for more information about 5-(Trifluoromethyl)-1H-Pyrazole-3-carboxylic Acid Ethyl Ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C7H7F3N2O2Degré de pureté :Min. 95%Masse moléculaire :208.14 g/mol3,3'-Dichlorodiphenylacetylene
CAS :3,3'-Dichlorodiphenylacetylene is a versatile building block that is used in the synthesis of complex compounds. It has been used as a reagent and as a speciality chemical for research purposes. This chemical can be used as a useful building block for the synthesis of other compounds, or it can be reacted with other compounds to form new compounds. 3,3'-Dichlorodiphenylacetylene is also an intermediate in organic syntheses and has been shown to react with many different types of molecules.
Formule :C14H8Cl2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :247.12 g/molC-Peptide (human) trifluoroacetate salt
CAS :C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.Formule :C129H211N35O48Degré de pureté :Min. 95%Masse moléculaire :3,020.26 g/molVIP sulfoxide (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about VIP sulfoxide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C147H238N44O43SDegré de pureté :Min. 95%Masse moléculaire :3,341.8 g/molBoc-Asp(OBzl)-chloromethylketone
CAS :Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.Formule :C17H22ClNO5Degré de pureté :Min. 95%Masse moléculaire :355.81 g/mol4,4'-Dibromobiphenyl
CAS :Produit contrôlé4,4'-Dibromobiphenyl is a diphenyl ether that is used in the synthesis of palladium complexes. It is also used as a carbon source for polymer films. The structural formula of 4,4'-dibromobiphenyl is C 12 H 10 Br 2 . This compound can be debrominated with hydrochloric acid to form biphenyl. 4,4'-Dibromobiphenyl has been shown to have anti-inflammatory properties and can be used as a specific antibody against dry weight.
Formule :C12H8Br2Degré de pureté :Min. 95%Masse moléculaire :312 g/mol3-Fluoro-4-nitrobenzoic acid
CAS :3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.Formule :C7H4FNO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :185.11 g/mol5-Bromo-2-hydroxy-3-methyl pyrazine
CAS :Please enquire for more information about 5-Bromo-2-hydroxy-3-methyl pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%2,5-Dinitrofluorene
CAS :2,5-Dinitrofluorene is a carcinogenic compound that has been shown to cause cancer in laboratory animals. It can be found in high concentrations in tissues of rats and other animals. 2,5-Dinitrofluorene is metabolized by nitroreductase to the amide form. This compound has been shown to cause cancer in rats and mice when administered intramammary or topically. The tumorigenicity of 2,5-dinitrofluorene is significant at high doses, but it does not show significant effects at low doses. This agent also causes tumours on the skin of mice when applied topically. 2,5-Dinitrofluorene is an environmental pollutant that may be found in air emissions from coal burning power plants and vehicle exhausts, as well as in the soil near these facilities.Formule :C13H8N2O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :256.21 g/molZ-2-Nal-chloromethylketone
CAS :Please enquire for more information about Z-2-Nal-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C22H20ClNO3Degré de pureté :Min. 95%Masse moléculaire :381.85 g/molEndomorphin-2 trifluoroacetate salt
CAS :Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.Formule :C32H37N5O5Degré de pureté :Min. 95%Masse moléculaire :571.67 g/molN-alpha-Z-L-lysine methyl ester hydrochloride
CAS :N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).
Formule :C15H22N2O4·HClDegré de pureté :Min. 95%Masse moléculaire :330.81 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS :The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.Formule :C54H56N6O13Degré de pureté :Min. 95%Masse moléculaire :997.06 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS :Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor forFormule :C54H78N16O10Degré de pureté :Min. 95%Masse moléculaire :1,111.3 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS :Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C68H107N19O17SDegré de pureté :Min. 95%Masse moléculaire :1,494.76 g/molLuteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt
CAS :Luteinizing Hormone-Releasing Hormone Antagonist trifluoroacetate salt is a potent antagonist of the luteinizing hormone-releasing hormone (LHRH) receptor. It is used specifically to treat platinum-resistant ovarian cancer, where it has been shown to be effective in reducing tumor size and volume. This drug has minimal toxicity and can be administered by injection or as a microcapsule. LHRH Antagonist trifluoroacetate salt is an analog of LHRH that has been modified so that it cannot cross the blood-brain barrier. It also binds to epidermal growth factor receptors, which are involved in cell proliferation, differentiation, and survival. Symptoms of overdose may include nausea, vomiting, headache, dizziness, seizures, and coma.Formule :C48H59ClN12O8Degré de pureté :Min. 95%Masse moléculaire :967.51 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate saltFormule :C186H275N51O59Degré de pureté :Min. 95%Masse moléculaire :4,169.48 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS :Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C78H111N21O16Degré de pureté :Min. 95%Masse moléculaire :1,598.85 g/mol2-Chloromethyl-3,5-dimethylpyridin-4-ol
CAS :Please enquire for more information about 2-Chloromethyl-3,5-dimethylpyridin-4-ol including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H10ClNODegré de pureté :Min. 95%Masse moléculaire :171.62 g/molH-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt
CAS :Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C32H40N6O10Degré de pureté :Min. 95%Masse moléculaire :668.69 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/molAlarin (human) trifluoroacetate salt
CAS :Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.Formule :C127H205N43O35Degré de pureté :Min. 95%Masse moléculaire :2,894.26 g/molH-Ala-Pro-pNA hydrochloride salt
CAS :H-Ala-Pro-pNA hydrochloride salt is a protease inhibitor that is used as a therapeutic agent for the treatment of hepatitis C. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, by binding to their active site. H-Ala-Pro-pNA hydrochloride salt also inhibits the activity of DPPIV (dipeptidyl peptidase IV), which is an enzyme that cleaves the third amino acid from peptides in some blood cells. H-Ala-Pro-pNA hydrochloride salt has been shown to be effective in preventing diabetic nephropathy in animal models by inhibiting DPPIV activity. H-Ala-Pro-pNA hydrochloride salt can be used to treat chronic hepatitis B and C infections. It binds to virus particles and prevents them from attaching themselves to host cells, thus preventing viral replication.Formule :C14H18N4O4Degré de pureté :Min. 95%Masse moléculaire :306.32 g/molNeuromedin U-23 (rat) trifluoroacetate salt
CAS :Neuromedin U-23 (rat) is a peptide that belongs to the family of tachykinins, which are small neuropeptides that act as neurotransmitters in the central nervous system. It is a potent stimulator of intestinal motility and has been shown to have protective effects against oxidative stress in cells. Neuromedin U-23 (rat) shares sequence similarity with human neuromedin N-19 and binds to the same receptors in the brain, suggesting it may have similar physiological effects. This peptide has been shown to inhibit tumor cell growth by inducing apoptosis, but it does not appear to have any effect on healthy cells.Formule :C124H180N34O31Degré de pureté :Min. 95%Masse moléculaire :2,642.97 g/molLIP1 (human) trifluoroacetate salt
Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C133H229N45O37Degré de pureté :Min. 95%Masse moléculaire :3,050.52 g/mol6-Hydroxy chlorzoxazone
CAS :6-Hydroxy chlorzoxazone is a drug that interacts with 5-hydroxy omeprazole, cytochrome P450 (CYP2E1), and chlorzoxazone. This drug is not metabolized by CYP2E1, but is metabolized by liver microsomes. The plasma concentration of 6-hydroxy chlorzoxazone increases as the patient's body mass index increases. It has been shown to affect the activity of hepatic enzymes such as CYP2E1 and p450 in rat liver microsomes. 6-Hydroxy chlorzoxazone may be used for the treatment of bronchial asthma and chronic obstructive pulmonary disease. The kinetic data for 6-hydroxy chlorzoxazone are based on studies done on humans and rats.Formule :C7H4ClNO3Degré de pureté :(%) Min. 95%Couleur et forme :Beige PowderMasse moléculaire :185.56 g/molH-Ala-Ala-pNA hydrochloride salt
CAS :Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H16N4O4Degré de pureté :Min. 95%Masse moléculaire :280.28 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS :Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.Formule :C28H34N4O7SDegré de pureté :Min. 95%Masse moléculaire :570.66 g/molACTH (1-14) trifluoroacetate salt
CAS :Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C77H109N21O20SDegré de pureté :Min. 95%Masse moléculaire :1,680.88 g/molMating Factor a trifluoroacetate salt
CAS :Please enquire for more information about Mating Factor a trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C82H114N20O17S·xC2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,683.97 g/mol2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide
CAS :2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide is a chelating agent that has been used as a control agent in the manufacture of dyes, plastics, and rubber. It is also used as an additive in paints, textiles, and paper. 2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide is nonvolatile, nonflammable, and does not produce toxic byproducts when heated. This compound has low molecular weight with a molecular formula of C12H13NO5Cl. The structure of this compound includes two hydroxy groups (OH), one aliphatic hydrocarbon group (CH3), one carboxylic acid group (COOH), and three chlorine atoms (Cl). This product is soluble in waterFormule :C17H15ClN4O5Couleur et forme :Yellow Clear LiquidMasse moléculaire :390.78 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS :Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.Formule :C45H79N11O15Degré de pureté :Min. 95%Masse moléculaire :1,014.17 g/molMyristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt
CAS :Please enquire for more information about Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C60H105N17O12Degré de pureté :Min. 95%Masse moléculaire :1,256.58 g/molAQEE-30 (human) trifluoroacetate salt
CAS :Please enquire for more information about AQEE-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C157H252N48O56Degré de pureté :Min. 95%Masse moléculaire :3,707.97 g/mol(Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct
CAS :Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C66H86N18O12Degré de pureté :Min. 95%Masse moléculaire :1,323.5 g/mol2-(2-Ethoxyphenoxy)ethyl bromide
CAS :2-(2-Ethoxyphenoxy)ethyl bromide is a substance that is found as an impurity in the drug sulphonamide. It has been shown to be an optical isomer of methanol and ethanol, which have base form. The substance crystallizes in the form of white needles and its base form is tamsulosin hydrochloride. It has been used as a reagent for organic chemistry reactions, such as recrystallization, and as an impurity in organic solvents.
Formule :C10H13BrO2Degré de pureté :Min. 95%Masse moléculaire :245.11 g/mol
![Ac-Val-Met-[(2S,4S,5S)-5-amino-4-hydroxy-2-isopropyl-7-methyl-octanoyl]-Ala-Glu-Phe-OH trifluoroac…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA111093.webp&w=3840&q=75)
![6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimeth…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN110943.webp&w=3840&q=75)
![2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFC149929.webp&w=3840&q=75)
