Halogénures organiques
Dans cette catégorie, vous trouverez des molécules organiques contenant un ou plusieurs atomes d'halogène dans leur structure. Ces halogénures organiques incluent des composés bromés, iodés, chlorés et des halogénures cycliques. Les halogénures organiques sont largement utilisés en synthèse organique, en pharmaceutique, en agrochimie et en science des matériaux en raison de leur réactivité et de leur capacité à subir une variété de transformations chimiques. Chez CymitQuimica, nous offrons une sélection complète d'halogénures organiques de haute qualité pour soutenir vos applications de recherche et industrielles, garantissant une performance fiable et efficace dans vos projets synthétiques et analytiques.
Sous-catégories appartenant à la catégorie "Halogénures organiques"
20442 produits trouvés pour "Halogénures organiques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS :Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.Formule :C47H75N13O11Degré de pureté :Min. 95%Masse moléculaire :998.18 g/mol5-bromo-2-(trifluoromethyl)benzoic Acid
CAS :Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H4BrF3O2Degré de pureté :Min. 95%Masse moléculaire :269.02 g/mol2,3-Dichloroanisole
CAS :2,3-Dichloroanisole is a volatile organic compound that has been shown to be an attractant for termites. It is used as a pesticide and agrochemical. 2,3-Dichloroanisole is used as an insecticide against termites and other pests in agriculture. This chemical has been shown to inhibit the sodium channel of the nerve cell membrane, which leads to paralysis of insects. The mechanism of action for this compound is not well understood but it has been suggested that it may act by blocking the reorientation of the sodium ion channels. 2,3-Dichloroanisole can also be used as a metal salt in some thermodynamic reactions.Formule :C7H6Cl2ODegré de pureté :Min. 97%Couleur et forme :PowderMasse moléculaire :177.03 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS :Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Masse moléculaire :555.632-Chloro-5-pyridylcarbinol
CAS :2-Chloro-5-pyridylcarbinol is an alkene that features a five-membered ring. It is a conformationally rigid molecule, which means it has no rotational or vibrational barriers. The molecule can be classified as a tricyclic heterocycle because the carbon atoms are arranged in three rings. The analogues of this compound feature six-membered carbocycles and intramolecular cycloadditions. 2-Chloro-5-pyridylcarbinol also constitutes one of the azomethine adducts of nicotine, which is a type of tricyclic heterocycle.Formule :C6H6ClNODegré de pureté :Min. 95%Masse moléculaire :143.57 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C189H284N54O56SDegré de pureté :Min. 95%Masse moléculaire :4,240.67 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C61H86N16O13Degré de pureté :Min. 95%Masse moléculaire :1,251.44 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N40O46Degré de pureté :Min. 95%Masse moléculaire :3,313.63 g/mol1H,1H,2H,2H-Heptadecafluorodecyl iodide
CAS :Produit contrôlé1H,1H,2H,2H-Heptadecafluorodecyl iodide is a volatile chemical that is used in the transport of various analytes. It can be used to detect alcohols and organic chemicals in the environment. 1H,1H,2H,2H-Heptadecafluorodecyl iodide has been sporadically found in the atmosphere of China.Formule :C10H4F17IDegré de pureté :Min. 95%Masse moléculaire :574.02 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS :Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C206H326N56O64SDegré de pureté :Min. 95%Masse moléculaire :4,643.2 g/mol2-Bromo-3-fluoroaniline
CAS :2-Bromo-3-fluoroaniline is a reactive and nucleophilic compound that is synthesized by the reaction of aniline with bromine and sodium hydroxide. The drug development of 2-bromo-3-fluoroaniline has been hampered by its toxicity, but it has shown promising results in animal studies for the treatment of cancer. Mechanistic studies have demonstrated that 2-bromo-3-fluoroaniline causes cell death by reacting with DNA. This drug also acts as a prodrug to fluoroacetic acid, which inhibits cell proliferation by inhibiting protein synthesis.Formule :C6H5BrFNDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :190.01 g/molZ-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a small molecule that has been shown to induce apoptosis in cultured cells. It is a caspase-3 inhibitor, which prevents the activation of the caspase cascade and protects cells from oxidative injury. Low doses of Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone have been shown to induce apoptosis in cultured cells, with no significant cytotoxicity at high doses. The mechanism of action for this agent is not yet known, but it may promote mitochondrial membrane potential loss and neuronal death by binding to DNA, or induce cell death through a caspase-independent pathway.Formule :C30H41FN4O12Degré de pureté :Min. 95%Masse moléculaire :668.66 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS :Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C189H295N55O51S2Degré de pureté :Min. 95%Masse moléculaire :4,217.84 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C37H67N9O11Degré de pureté :Min. 95%Masse moléculaire :813.98 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS :N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats. The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.Formule :C7H12Cl2N2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :195.09 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS :Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H109N19O16Degré de pureté :Min. 95%Masse moléculaire :1,508.77 g/mol2-Cyclohexylethanamine hydrochloride
CAS :Please enquire for more information about 2-Cyclohexylethanamine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H18ClNDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :163.69 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C134H207N41O36SDegré de pureté :Min. 95%Masse moléculaire :3,000.4 g/mol2-Fluoro-6-methoxybenzonitrile
CAS :2-Fluoro-6-methoxybenzonitrile (2FMN) is a compound that is used as a starting material for the synthesis of other pharmaceuticals. It has been shown to bind to the acetylcholine receptor by using vibrational spectroscopy and functional theory. It also has been shown to be an effective chemokine inhibitor. Computational methods were used to optimize 2FMN's binding affinity for the acetylcholine receptor, and it was found that 2FMN binds with a dipole orientation in order to increase its binding affinity.
Formule :C8H6FNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :151.14 g/molIron(III) trifluoromethanesulfonate
CAS :Iron trifluoromethanesulfonate is an inorganic compound that is used as a catalyst in organic reactions. It is a salt of iron(III) and triflic acid, with the formula Fe(O)(CF). It has been shown to be a cocatalyst for benzofuran derivatives and can be used to synthesize methyl ketones, alkylation products, diarylmethanes, primary alcohols, and cleavage products. Iron trifluoromethanesulfonate can also be used as a control experiment to study reaction mechanisms.Formule :C3F9FeO9S3Degré de pureté :Min. 95%Couleur et forme :White SolidMasse moléculaire :503.06 g/molTris[4-(trifluoromethyl)phenyl]phosphine
CAS :Tris[4-(trifluoromethyl)phenyl]phosphine (TFPP) is a diphosphine ligand that binds to metal ions in the active site of enzymes. It has been shown to bind to methylenecyclopropanes, which are intermediates in the reaction of Grignard reagents with quinoline derivatives. TFPP is also able to form complexes with phosphines and other ligands, such as borane. The crystal structures of TFPP have been determined by x-ray diffraction studies. These structures show that TFPP is monosubstituted with four trifluoromethyl groups and one phosphorus atom.br>br> TFPP has also been shown to be an effective catalyst for reactions involving amides, such as hydroamination and acylation reactions. In addition, it was found that TFPP inhibits the growth of bacteria by inhibitingFormule :C21H12F9PDegré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :466.28 g/molAdrenomedullin (porcine) trifluoroacetate salt
CAS :Please enquire for more information about Adrenomedullin (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C262H403N79O76S3Degré de pureté :Min. 95%Masse moléculaire :5,971.69 g/molButyl Trifluoromethanesulfonate
CAS :Butyl trifluoromethanesulfonate is an immunoregulatory agent that has been shown to have insulin-sensitizing and anti-inflammatory properties. It has been reported to cause a significant reduction in the concentration of glucose in the blood, which may be due to its ability to inhibit the synthesis of cholesterol esters. Butyl trifluoromethanesulfonate is also used as a solvent in detergent compositions, and as a reagent for synthesizing quinoline derivatives. This compound has been shown to increase the viscosity of oils and other organic solvents, making it useful for a wide range of industrial applications.Formule :C5H9F3O3SDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :206.18 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/mol(R)-2-Methylmorpholine hydrochloride
CAS :Please enquire for more information about (R)-2-Methylmorpholine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C5H12ClNODegré de pureté :Min. 95%Masse moléculaire :137.61 g/mol4-Bromo-2-pyrrolecarboxaldehyde
CAS :4-Bromo-2-pyrrolecarboxaldehyde is a synthetic chemical that is used as an antifungal agent. It inhibits the growth of filamentous fungi by binding to their pyrrole rings and inhibiting the synthesis of proteins. 4-Bromo-2-pyrrolecarboxaldehyde has shown in vitro antifungal activity against isolates of Candida albicans, Aspergillus niger, and Fusarium oxysporum. This compound also has substitutions at positions 1 and 2 of the pyrrole ring, which are thought to be responsible for its inhibitory properties. 4-Bromo-2-pyrrolecarboxaldehyde is soluble in organic solvents such as acetone and chloroform.Formule :C5H4BrNODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :174 g/mol(1R,3S)-3-Aminocyclopentanol hydrochloride
CAS :Intermediate in the synthesis of bictegravirFormule :C5H12ClNODegré de pureté :Min. 95%Masse moléculaire :137.61 g/molHepcidin-24 (human) trifluoroacetate salt
Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C109H165N33O28S9Degré de pureté :Min. 95%Masse moléculaire :2,674.28 g/mol(alphaR)-alpha-[[[2-(4-Nitrophenyl)ethyl]amino]methyl]benzenemethanol hydrochloride
CAS :Intermediate in the synthesis of mirabegron
Formule :C16H18N2O3·HClDegré de pureté :Min. 95%Masse moléculaire :322.79 g/molBoc-Asp(OBzl)-chloromethylketone
CAS :Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.Formule :C17H22ClNO5Degré de pureté :Min. 95%Masse moléculaire :355.81 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS :Intermediate in the synthesis of tedizolidFormule :C21H17FN6O2Degré de pureté :Min. 95%Masse moléculaire :404.4 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS :Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C66H88N14O14Degré de pureté :Min. 95%Masse moléculaire :1,301.49 g/mol8-Bromo-1-octanol
CAS :8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.
Formule :C8H17BrODegré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :209.12 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C99H153N29O26S5Degré de pureté :Min. 95%Masse moléculaire :2,325.78 g/molGRF (bovine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C220H366N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,107.77 g/molOrphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS :Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C127H195N37O37Degré de pureté :Min. 95%Masse moléculaire :2,832.13 g/molMethyl 5-bromo-2-nitrobenzoate
CAS :Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%(2-Chloropyridin-4-yl)methanamine
CAS :2-Chloropyridin-4-yl)methanamine is a hydrogenated molecule that has been shown to inhibit the activity of certain cancer cells. It inhibits the expression of the enzyme molecules involved in the synthesis of DNA and RNA. 2-Chloropyridin-4-yl)methanamine also inhibits the hydrolysis of hydrogen chloride (HCl) to produce hydrogen (H2). This drug is used as an inhibitor for medicines that require acidic pH for absorption, such as HCl.Formule :C6H7ClN2Degré de pureté :Min. 95%Masse moléculaire :142.59 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H85N19O13Degré de pureté :Min. 95%Masse moléculaire :1,208.37 g/molUrocortin (human) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C204H337N63O64Degré de pureté :Min. 95%Masse moléculaire :4,696.24 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C196H288N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.79 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS :Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N42O39Degré de pureté :Min. 95%Masse moléculaire :3,229.65 g/molH-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-Glu(OtBu)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%ACV trifluoroacetate salt
CAS :ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.Formule :C14H25N3O6SDegré de pureté :Min. 95%Masse moléculaire :363.43 g/mol2-Bromoethylamine hydrobromide
CAS :2-Bromoethylamine HBr is a nonsteroidal anti-inflammatory drug that is used to treat inflammation and pain. It is a prodrug that is hydrolyzed in vivo to its active form, 2-bromoethylamine. The bound form of this drug has been shown to inhibit the development of cell nuclei in the nucleus of cells. This drug also inhibits the production of nitric oxide, which leads to cell death by necrosis. 2-Bromoethylamine HBr has been shown to have an inhibitory effect on the activity of glycol ethers, which are used as solvents for resins in coatings and adhesives. It also has the ability to form body tissue (e.g., papillary) and can be used as an experimental model for studying necrosis.Formule :C2H6BrN•HBrDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :204.89 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS :Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C53H106N30O11Degré de pureté :Min. 95%Masse moléculaire :1,339.6 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS :Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C80H138N26O24S2Degré de pureté :Min. 95%Masse moléculaire :1,912.24 g/molTRAP-5 amide trifluoroacetate salt
CAS :Please enquire for more information about TRAP-5 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C30H51N9O6Degré de pureté :Min. 95%Masse moléculaire :633.78 g/molNeurokinin B trifluoroacetate salt
CAS :Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br> Neurokinin B trifluoroacetate salt H Asp Met His Asp PFormule :C55H79N13O14S2Degré de pureté :Min. 95%Masse moléculaire :1,210.43 g/molL-Tyrosine methyl ester hydrochloride
CAS :L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.Formule :C10H14ClNO3Degré de pureté :Min. 95%Masse moléculaire :231.68 g/mol
![Tris[4-(trifluoromethyl)phenyl]phosphine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFT100710.webp&w=3840&q=75)
![(alphaR)-alpha-[[[2-(4-Nitrophenyl)ethyl]amino]methyl]benzenemethanol hydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN156825.webp&w=3840&q=75)
![N-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFF102200.webp&w=3840&q=75)
