Produits biochimiques et réactifs

The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.

The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.

A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf71 antibody, catalog no. 70R-9196

A-278637 is a quinoline derivative that has been shown to be effective in treating acute decompensated heart failure. The mechanism of the drug is not fully understood, but it is thought to inhibit the opening of certain membrane channels in the bladder and detrusor muscle. A-278637 has also been shown to produce a significant increase in systolic pressure, which may be due to its ability to activate cardiac β 1 -adrenergic receptors.

Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A6 antibody, catalog no. 70R-7524

Peptide H-NVNDVIAPAFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of DLG3 antibody, catalog no. 70R-6604

Purified recombinant Human POLR2E protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM115 antibody, catalog no. 70R-7397

A synthetic peptide for use as a blocking control in assays to test for specificity of Wnt10a antibody, catalog no. 70R-8497

Cereblon modulator 1 is a prodrug that binds to the E3 ubiquitin ligase, Cereblon, and blocks its activity. This drug is being studied for use in hematologic malignancies. Cereblon modulator 1 has been shown to inhibit the proliferation of myelodysplastic cells by inducing c-myc protein degradation and inhibiting IL-1 receptor activation. The drug also inhibits the growth of cancer cells by blocking the Tautomerase function of Cereblon, thereby preventing the conversion of inactive proteins into active proteins. Cereblon modulator 1's linker is heterocyclic, which is likely responsible for its antagonist effect on IL-1 receptor activation.

A synthetic peptide for use as a blocking control in assays to test for specificity of TLK2 antibody, catalog no. 70R-9600

The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.

Rabbit polyclonal MAD4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of A1BG antibody, catalog no. 70R-8009

A synthetic peptide for use as a blocking control in assays to test for specificity of PTBP1 antibody, catalog no. 70R-4626

A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP19 antibody, catalog no. 70R-10160

ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM

BMS 536924 is a novel small molecule that is an ATP-binding cassette transporter (ABC) inhibitor. It has been shown to inhibit the ABCB1, ABCC1 and ABCG2 transporters in vitro. BMS 536924 has also been shown to increase cytosolic calcium levels in prostate cancer cells. This drug was found to induce apoptosis in insulin-stimulated glucose-6-phosphatase (IGP)-deficient mouse fibroblasts, which may be due to its ability to inhibit IGF-I production.

A synthetic peptide for use as a blocking control in assays to test for specificity of ESR1 antibody, catalog no. 70R-5681

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB6 antibody, catalog no. 70R-10057

The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.

DYX1C1 antibody was raised in Rabbit using Human DYX1C1 as the immunogen

Disalicylimide is an organometallic compound that contains a carbon-carbon double bond. It is unsaturated and has a hydration reaction with the perchlorates in the environment. Disalicylimide also reacts with benzamidine, which leads to the formation of salicylidene, which is an acidic compound. This compound is used as an oral dosage for rheumatoid arthritis, osteoarthritis and other arthritic conditions. Disalicylimide can also interact with 5-nitrosalicylaldehyde, which is a carcinogen.

Affinity purified Rabbit polyclonal RAB3C antibody

Ob 24 is an ion channel activator that is a potent and selective inhibitor of the TRPV1 receptor. Ob 24 has been shown to inhibit the activity of TRPV1 receptors in rat sensory neurons, both in vitro and in vivo. Ob 24 can be used as a research tool to study TRPV1 receptor-mediated events, such as pain sensation and inflammation. It has also been used as a pharmacological tool for the investigation of protein interactions with TRPV1 receptors.
TRPV1 receptors are known to play an important role in various physiological processes, including pain sensation, inflammation, and cell proliferation. Ob 24 can also be used to activate cells that express TRPV1 receptors. This compound may have applications in cancer therapy by activating tumor cells that express TRPV1 receptors.

Rabbit polyclonal GPR152 antibody

Glyt1 inhibitor 1 is a chemical compound that acts as an inhibitor of the GlyT1 transporter, which is a product of synthetic chemistry. This inhibitor binds selectively to the glycine transporter-1 (GlyT1), a key protein responsible for the reuptake of glycine, an important neurotransmitter, in the central nervous system. By inhibiting GlyT1, this compound increases glycine levels in synaptic clefts, which can enhance N-methyl-D-aspartate (NMDA) receptor activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of PI4K2B antibody, catalog no. 70R-3490

A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6503

A synthetic peptide for use as a blocking control in assays to test for specificity of CHKA antibody, catalog no. 70R-3628

A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171

A synthetic peptide for use as a blocking control in assays to test for specificity of RPS16 antibody, catalog no. 20R-1082

A synthetic peptide for use as a blocking control in assays to test for specificity of LDHC antibody, catalog no. 70R-2542

A synthetic peptide for use as a blocking control in assays to test for specificity of HCCS antibody, catalog no. 70R-10236

Clothiapine is a psychotropic agent, which is a type of drug used in psychiatry. It is sourced from the dibenzothiazepine class of compounds. As a thioxanthene derivative, clothiapine acts as a dopamine receptor antagonist, specifically targeting D2 receptors. This mode of action results in its antipsychotic effects by modulating neurotransmitter pathways in the brain, particularly those involving dopamine, which is often implicated in psychiatric disorders.

A synthetic peptide for use as a blocking control in assays to test for specificity of SEC23B antibody, catalog no. 70R-3255

A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD1 antibody, catalog no. 70R-3130

The Cul4B antibody is a highly specialized and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the Cul4B protein, which plays a crucial role in various cellular processes. The Cul4B protein is involved in the regulation of epidermal growth factor signaling, parathyroid hormone-related protein expression, and chemokine-like activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of CNN2 antibody, catalog no. 70R-2274

A synthetic peptide for use as a blocking control in assays to test for specificity of YARS antibody, catalog no. 70R-1482

GFPT1 antibody was raised in Rabbit using Human GFPT1 as the immunogen

The Histamine H4 Receptor antibody is a powerful tool for researchers in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs.

CAT antibody was raised in Rabbit using Human CAT as the immunogen

Affinity purified Rabbit polyclonal KRTHA3B antibody

Mouse monoclonal HIV1 p55+17 antibody

The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.

Mouse monoclonal CXCR1 antibody

DLAT antibody was raised in Rabbit using Human DLAT as the immunogen

FGF1 protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. FGF1 protein has been shown to interact with TGF-beta and adiponectin receptors, leading to the activation of signaling pathways that promote adipocyte function. It has also been found to stimulate collagen synthesis in adipose tissue and enhance insulin sensitivity.

GMPPB antibody was raised in Rabbit using Human GMPPB as the immunogen

Rabbit polyclonal USP3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CDH4 antibody, catalog no. 70R-6191

A synthetic peptide for use as a blocking control in assays to test for specificity of Cpne5 antibody, catalog no. 70R-9505

Inhibitor of fatty acid amide hydrolase

Affinity purified Rabbit polyclonal FBXL3 antibody

Please enquire for more information about Guangxitoxin 1E trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

NFE2 antibody was raised in Rabbit using Human NFE2 as the immunogen

Bicalutamide-d4 is a monocarboxylic acid that is a competitive inhibitor of androgens. It binds to the cytosolic receptor and blocks the action of dihydrotestosterone (DHT). Bicalutamide-d4 has been shown to be effective in reducing prostate cancer tumour growth, but not in treating prostate cancer. This drug is non-steroidal and acts as an antagonist of androgen receptors. Bicalutamide-d4 has been shown to induce the production of monocarboxylic acid metabolites such as sulfone and amide, which have anti-inflammatory effects on tissues.

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPF antibody, catalog no. 70R-5368

FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Chodl antibody, catalog no. 70R-9251

PF-06427878 is a small molecule that activates AMP-activated protein kinase (AMPK), which plays important roles in regulating cellular energy metabolism. It has been shown to have clinical efficacy in reducing body mass index and triglycerides, and to be safe for use in patients with cirrhosis. PF-06427878 also activates the fatty acid oxidation pathway, resulting in decreased body fat content and improved insulin sensitivity. Further studies are required to determine the effects of this drug on other metabolic pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of CUL4A antibody, catalog no. 70R-10348

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

NHS-dPEG®4-( m-dPEG®12)3-Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-( m-dPEG®12)3-Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A synthetic peptide for use as a blocking control in assays to test for specificity of SOX7 antibody, catalog no. 70R-8385

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

Peptide H-IYTWIEDHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KHKHKHKHKHKHKHKHKHKKLFKKILKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

NVP-BVU972 is a small molecule inhibitor of the tyrosine kinase activity of the epidermal growth factor receptor. It has been shown to inhibit the growth of cancer cells in vitro and in vivo. NVP-BVU972 binds to the ATP binding site of the kinase domain and inhibits protein synthesis by preventing phosphorylation of downstream substrates. This drug also has a pharmacokinetic profile that is not affected by renal or hepatic dysfunction. NVP-BVU972 is currently being evaluated as a predictive biomarker for cancer treatment response.

A synthetic peptide for use as a blocking control in assays to test for specificity of ITFG1 antibody, catalog no. 70R-6176

Purified recombinant Human KCTD15 protein (His tag)

Gly-Pro-AMC is a peptide that can be used as a research tool to investigate protein interactions. Gly-Pro-AMC is an activator of ion channels and is able to inhibit ligand binding to receptor. It has been used in pharmacology for the study of protein interactions, ion channels, and receptors. Gly-Pro-AMC binds to the cell membrane and blocks the activation of potassium channels. It also inhibits ligand binding to receptors. This compound has been found in high purity with a CAS number of 67341-42-8.

A synthetic peptide for use as a blocking control in assays to test for specificity of AMBN antibody, catalog no. 70R-10326

FAM185A antibody was raised in Rabbit using Human FAM185A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ACP1 antibody, catalog no. 70R-3910

A synthetic peptide for use as a blocking control in assays to test for specificity of DCXR antibody, catalog no. 70R-3264

GPR18 antibody was raised in rabbit using the middle region of GPR18 as the immunogen

The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.

Rabbit polyclonal MRCKB antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ALS2CR12 antibody, catalog no. 70R-3279

A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD2 antibody, catalog no. 70R-1809

A synthetic peptide for use as a blocking control in assays to test for specificity of LDB3 antibody, catalog no. 70R-1141