Produits biochimiques et réactifs

VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.

Rabbit polyclonal alpha Synuclein antibody (Tyr136)

Soporidine is an inhibitor of protein interactions, which is used in the study of receptor-ligand interactions. Soporidine has been shown to activate some receptors and inhibit others. It has also been shown to be a potent inhibitor of ion channels and may be useful as a research tool for studying ion channel function.

Rabbit polyclonal NUDT19 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PKDREJ antibody, catalog no. 70R-5204

A synthetic peptide for use as a blocking control in assays to test for specificity of AGPAT5 antibody, catalog no. 70R-7253

A synthetic peptide for use as a blocking control in assays to test for specificity of MOSPD3 antibody, catalog no. 70R-1823

Rabbit polyclonal CXCL11 antibody (FITC)

Kazusamycin A is a β-amino acid that has potent antitumor activity. It inhibits the growth of subcutaneous tumors in mice, and has been shown to inhibit protein synthesis. Kazusamycin A also has potent inhibitory activity against fatty acid synthase, which is an enzyme that catalyzes the synthesis of fatty acids from acetyl-CoA. This inhibition may be responsible for its potent anti-tumor effects, as well as its ability to prevent tumor metastasis and cancer progression. Kazusamycin A also has been shown to have immunosuppressive effects and could be used for the treatment of autoimmune diseases such as rheumatoid arthritis or lupus erythematosus.

CPN-267 is a peptide that is an inhibitor of protein interactions. It has been shown to be a potent inhibitor of the activation of the receptor for the amyloid beta peptide. CPN-267 also inhibits ligand binding to the acetylcholine receptor, and blocks ion channels in neuronal cells. This drug has also been shown to inhibit the activity of some proteins involved in cancer cell proliferation and survival. CPN-267 has been used as a research tool for studying protein interactions and has been labeled with fluorochrome to allow for visualization under a microscope.
CAS: 93627-03-3

09:0 PC is a phospholipid that has shown the ability to protect against renal ischemia-reperfusion injury in rats. This protection was seen both in vitro and in vivo, as well as for apoptosis induced by serum deprivation. 09:0 PC was also found to have an anti-inflammatory effect on rat cardiomyocytes. These effects were due to its ability to inhibit phospholipases and neutralize reactive oxygen species (ROS). It has been found that 09:0 PC contains a serine residue at the active site, which may be important for its activity. Further research on the mechanism of 09:0 PC's activity is needed to understand how it protects cells from injury and death.

Rabbit polyclonal PPP1R1B antibody (Thr75)

A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB1BP3 antibody, catalog no. 70R-2141

Rabbit polyclonal CBX6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of OSGEP antibody, catalog no. 70R-3838

IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen

The GPR75 antibody is a powerful tool used in the field of life sciences. It specifically targets glucagon, a hormone involved in regulating glucose levels in the body. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.

Taurochenodeoxycholate-3-sulfate is a conjugate of taurochenodeoxycholic acid and 3-sulfate. It is a bile acid that has been used in clinical studies to determine the transport properties of unconjugated taurochenodeoxycholic acid. Taurochenodeoxycholate-3-sulfate has an inhibitory effect on the uptake of dinucleotide phosphate and fatty acids by cells, which may be due to its ability to bind to plasma membrane receptors. This drug also has a role in the metabolism of drugs and other xenobiotics. Taurochenodeoxycholate-3-sulfate is found in urine samples from humans, although it can also be detected in breast milk, amniotic fluid and tissue biopsies. In rats, this drug has been shown to have an influence on body mass index and metabolic profiles.

The Pyruvate Kinase antibody is a highly specialized monoclonal antibody that targets the pyruvate kinase enzyme. This antibody has been extensively studied in the field of Life Sciences and has shown significant potential for use in various applications. It exhibits cytotoxic activity against cancer cells, making it a promising candidate for targeted therapies. Additionally, this antibody has been found to interact with fibronectin, collagen, and other glycoproteins, indicating its potential role in cell adhesion and migration processes. Furthermore, studies have demonstrated that the Pyruvate Kinase antibody can modulate the production of interleukin-6 and activate the p38 MAPK pathway. With its unique properties and versatility, this antibody holds great promise for further research and development in the fields of oncology, immunology, and drug discovery.

EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal AGR3 antibody

Affinity purified Rabbit polyclonal AKT1/2 antibody

Rabbit polyclonal TIMM9 antibody

PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Sulfamethoxazole-d4 is a deuterated analog of sulfamethoxazole, which is a synthetic antibacterial agent. It is primarily sourced from chemical synthesis processes that involve replacing hydrogen atoms with deuterium in the sulfamethoxazole molecule. This isotope labeling provides a distinctive advantage in pharmacokinetic studies, as it allows for the precise tracking and differentiation of the deuterated form from the non-labeled drug in biological systems.

LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of GTSE1 antibody, catalog no. 70R-5612

ELISA Kit for detection of IgG in the research laboratory

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

MAT2B antibody was raised in Rabbit using Human MAT2B as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF21 antibody, catalog no. 70R-7993

Affinity purified Rabbit polyclonal PEX19 antibody

Rabbit polyclonal AKAP2 antibody

Rabbit polyclonal COL4A1 antibody (FITC)

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF276 antibody, catalog no. 70R-8223

A synthetic peptide for use as a blocking control in assays to test for specificity of HBP1 antibody, catalog no. 70R-8294

A synthetic peptide for use as a blocking control in assays to test for specificity of UEVLD antibody, catalog no. 70R-3803

RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI

ZNF605 antibody was raised in rabbit using the N terminal of ZNF605 as the immunogen

The Fibronectin antibody is a polyclonal antibody that specifically targets fibronectin, a glycoprotein involved in cell adhesion and migration. This antibody is widely used in life sciences research to study the role of fibronectin in various biological processes. It can be used to detect and quantify fibronectin levels in different samples, such as tissues or cell cultures. The Fibronectin antibody has also been shown to have potential therapeutic applications, particularly in cancer treatment. Studies have demonstrated its ability to inhibit tumor growth by blocking the interaction between fibronectin and its receptor on cancer cells. Additionally, this antibody has been used in combination with other drugs, such as sorafenib, to enhance their anti-cancer effects. Whether you are conducting research or developing new therapies, the Fibronectin antibody is an essential tool for studying fibronectin biology and its potential applications in various fields of medicine.

Armenian Hamster monoclonal CD11c antibody (FITC)

The PRUNE antibody is a monoclonal antibody that specifically targets the cysteine-rich protein known as PRUNE. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. PRUNE is a multifunctional protein that acts as a growth factor and glycoprotein, playing a crucial role in cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR23 antibody, catalog no. 70R-3939

ELISA Kit for detection of IgG in the research laboratory

LY 233053 is a polylactic acid-based drug that is used in the treatment of inflammatory pain. It has been shown to have a high affinity for glutamate receptors, which may be due to its carbonyl group. LY 233053 also has an anti-cancer effect, as it inhibits the growth of cancer cells by stimulating neuronal death. LY 233053 is not absorbed orally and must be given intravenously or intramuscularly. This drug is also used in diagnostic agents for research on glutamate and the brain.

Armenian Hamster monoclonal CD49e antibody (FITC)

Rabbit polyclonal SPAG11A antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ALG2 antibody, catalog no. 70R-2876

Affinity purified Rabbit polyclonal Slap antibody

Rabbit polyclonal TMX2 antibody

SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK

The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.

A synthetic peptide for use as a blocking control in assays to test for specificity of CHRNA5 antibody, catalog no. 70R-8064

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF699 antibody, catalog no. 70R-9018

A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL14 antibody, catalog no. 20R-1308

The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.

Purified recombinant DKK3 protein (His tag)

Rabbit polyclonal VEGFC antibody (HRP)

Affinity purified Rabbit polyclonal FHL5 antibody

Rabbit polyclonal URB1 antibody

SM1-71 is a small molecule that is designed to inhibit the influenza virus by binding to an essential protein. SM1-71 inhibits the activity of c-Jun, which is a transcription factor that regulates the expression of genes involved in cell signaling pathways. The SM1-71 molecule has been shown to inhibit viral replication in cells and protect mice from experimental influenza infection. This drug also reduces body weight and allergic symptoms in mice. It has been shown to be effective against wild-type virus strains, but not against mutant viruses with decreased susceptibility to SM1-71.

Rabbit polyclonal HMGB1 antibody (FITC)

Rabbit polyclonal UTP23 antibody

IRF9 antibody was raised in Rabbit using Human IRF9 as the immunogen

The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.

CD3 antibody (FITC) was raised in Mouse using a purified recombinant fragment of human CD3 expressed in E. coli as the immunogen.

HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK

Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&L) as the immunogen.

Mouse monoclonal GSTO2 antibody

Dual FAK/IGF1R kinase inhibitor; anti-cancer agent

Rabbit polyclonal Spa17 antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of MANEA antibody, catalog no. 70R-7439

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54B antibody, catalog no. 70R-5652

Purified native Ovomucoid protein (Chicken)

Rabbit polyclonal SFPQ antibody

The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.

Mouse monoclonal GSTT2 antibody

The PYY protein is a recombinant protein that falls under the category of Recombinant Proteins & Antigens. It is commonly used in the field of Life Sciences for various applications. PYY protein is known to have autoantibodies and can be used to detect specific oligonucleotides. It can also be utilized as a monoclonal antibody in research and diagnostic settings.

A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3B antibody, catalog no. 70R-2297