Produits biochimiques et réactifs

RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

The Influenza B protein is a native protein and antigen that plays a crucial role in the life sciences field. It has been extensively studied for its association with various autoantibodies found in human serum. Additionally, this protein has been shown to interact with gapdh and androgen, making it an important target for research in the field of adipose biology. Monoclonal antibodies specific to the Influenza B protein have been developed, further highlighting its significance in scientific investigations. Moreover, this protein has been found to be involved in nuclear functions within adipocytes, suggesting its potential role in regulating cellular processes. With its diverse applications and interactions, the Influenza B protein continues to be a valuable tool for researchers studying various aspects of life sciences.

The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF766 antibody, catalog no. 70R-8881

DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

SARS-CoV-2 coronavirus spike glycoprotein RBD protein

Mouse monoclonal SLFNL1 antibody

Rat monoclonal CD2 antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZIK1 antibody, catalog no. 20R-1272

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf159 antibody, catalog no. 70R-7031

A synthetic peptide for use as a blocking control in assays to test for specificity of ZSWIM3 antibody, catalog no. 70R-3646

A synthetic peptide for use as a blocking control in assays to test for specificity of SLBP antibody, catalog no. 70R-4639

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds known for their potent bactericidal activity. The key mechanism of action involves binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes, confirming its high efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also exhibits specific binding to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.

GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Rabbit polyclonal SNRPD3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SQSTM1 antibody, catalog no. 70R-5720

The CTNNB1 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways. This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.

The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of RFFL antibody, catalog no. 70R-2767

Affinity purified Rabbit polyclonal BUB3 antibody

MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.

A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-269F19.9 antibody, catalog no. 70R-4209

Rabbit polyclonal RANBP9 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DPH2 antibody, catalog no. 70R-3392

Rel antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody is produced using state-of-the-art technology and contains high-quality excipients to ensure stability and efficacy. Rel antibody has been extensively tested and validated for use in various applications, including ELISA assays, Western blotting, immunohistochemistry, and more. It is highly specific and exhibits strong binding affinity towards EGF, making it a valuable tool for studying EGF-related signaling pathways. Whether you're investigating the role of EGF in cancer development or exploring its effects on insulin signaling, Rel antibody is an essential component of your research toolkit. Trust in its reliability and accuracy to enhance your scientific discoveries.

CHMP7 antibody was raised in Rabbit using Human CHMP7 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PDLIM3 antibody, catalog no. 70R-2995

A synthetic peptide for use as a blocking control in assays to test for specificity of PCBP4 antibody, catalog no. 70R-5654

FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.

The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of CAMK1D antibody, catalog no. 70R-3991

Rabbit polyclonal SNX19 antibody

ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen

LIPA antibody was raised in rabbit using the N terminal of LIPA as the immunogen

Rabbit polyclonal SYT1 antibody (Thr202)

The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.

DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.

MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of KL antibody, catalog no. 70R-7494

C11orf70 antibody was raised in Rabbit using Human C11orf70 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL1 antibody, catalog no. 70R-9645

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1995

Rabbit polyclonal CEB beta antibody

Affinity purified Rabbit polyclonal EPH receptor A8 antibody

TOMM70A antibody was raised in rabbit using the N terminal of TOMM70A as the immunogen

The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.

A synthetic peptide for use as a blocking control in assays to test for specificity of ABP1 antibody, catalog no. 70R-5440

Rabbit polyclonal RAB3B antibody

Tazifylline is an anti-inflammatory drug that belongs to the group of non-steroidal anti-inflammatory drugs. It is a racemic mixture of two enantiomers, (+)-tazifylline and (-)-tazifylline, which have different pharmacological properties. Tazifylline has been shown to inhibit leukotriene synthesis by competitive inhibition of leukotriene receptors. This drug also inhibits the production of bronchial reactivity in guinea pigs as well as the development of idiopathic urticaria in humans. Tazifylline has a terminal half-life of 2 hours and is administered orally or intravenously at a dosage between 50 and 100 mg/day.

A synthetic peptide for use as a blocking control in assays to test for specificity of CD200R1 antibody, catalog no. 70R-9902

YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE

SID 26681509 is an enzyme inhibitor that inhibits toll-like receptor (TLR) signaling pathways. TLRs are a family of proteins that act as pattern recognition receptors for the detection of microbial or viral components. SID 26681509 has been shown to inhibit HIV infection in primary cells and to induce autophagy, which may be due to its ability to inhibit methyl transferase activity. It also has been shown to reduce inflammation in mouse models of autoimmune diseases by inhibiting chemoattractant protein expression.

Rabbit polyclonal PTPN18 antibody

Nociceptin is a neuropeptide that acts as an endogenous ligand for the opioid receptor. It has been shown to be an antagonist of opioid receptors, although it also activates potassium channels. Nociceptin has been used as a research tool in pharmacology and protein interactions, where it has been shown to inhibit the binding of opioid receptor-specific antibodies and to activate potassium-selective ion channels. Nociceptin is a high purity peptide with CAS No. 205252-57-9.

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-5026

ICI 154129 is a potent and selective δ-opioid receptor antagonist. It has been shown to produce antinociceptive effects in animal models of pain, and ICI 154129 has been shown to have an addictive potential in animals. ICI 154129 binds to the δ-opioid receptor with high affinity and selectivity, with a K i of 0.5 nM. It also binds to other opioid receptors at higher concentrations, including β-opioid receptors (K i = 1.3 nM) and μ-opioid receptors (K i = 2.6 nM). ICI 154129 is a competitive antagonist at all three opioid receptors, preventing binding of endogenous or exogenous agonists or antagonists. There are very few side effects associated with this drug, which may be due to its low affinity for other targets such as dopamine or serotonin receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF326 antibody, catalog no. 20R-1244

ELISA Kit for detection of von Willebrand Factor in the research laboratory

Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.

The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.

A synthetic peptide for use as a blocking control in assays to test for specificity of CMTM2 antibody, catalog no. 70R-6338

A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf39 antibody, catalog no. 70R-2926

A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G1 antibody, catalog no. 20R-1168

The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (351-365) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

A synthetic peptide for use as a blocking control in assays to test for specificity of NHEDC2 antibody, catalog no. 70R-6490

A synthetic peptide for use as a blocking control in assays to test for specificity of NT5DC2 antibody, catalog no. 70R-4565

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

LTA4H-IN-1 is a pentobarbital sodium salt that inhibits the activity of serine proteases. It is used as an immunosuppressive agent in cancer and autoimmune diseases. The effects of LTA4H-IN-1 on symptoms, diameter, and particle size have been studied using polymer films with different degrees of thermal expansion. An increase in the degree of thermal expansion leads to an increase in the size of particles and a decrease in the duration of symptoms.

CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PABPC4 antibody, catalog no. 70R-4874

The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.

IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1a as the immunogen.

Affinity purified Rabbit polyclonal GABPB1 antibody

GIMAP5 antibody was raised in Rabbit using Human GIMAP5 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen

Mouse anti-25OH Vitamin D2/D3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DGAT2L3 antibody, catalog no. 70R-6781

Glucokinase activator, cpd A is a peptide that can be used as a research tool. The protein interacts with the glucokinase receptor and inhibits it, which is a key enzyme in carbohydrate metabolism. Glucokinase activator, cpd A has been shown to inhibit ion channels, and is an inhibitor of the alpha-subunit of the GABA receptor. It also binds to a number of other receptors. This product has high purity and is CAS No. 603108-44-7.

KBTBD10 antibody was raised in rabbit using the N terminal of KBTBD10 as the immunogen