Produits biochimiques et réactifs

Rabbit polyclonal PDK1 antibody (Tyr9)

The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.

RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

A synthetic peptide for use as a blocking control in assays to test for specificity of PYCR1 antibody, catalog no. 70R-5378

SPDP-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A synthetic peptide for use as a blocking control in assays to test for specificity of NLRP2 antibody, catalog no. 70R-9470

Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HBXIP antibody, catalog no. 70R-2217

Affinity purified Rabbit polyclonal NDUFB9 antibody

CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP5C antibody, catalog no. 70R-5672

The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E1 antibody, catalog no. 70R-3089

Affinity purified Rabbit polyclonal CDC26 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MATN3 antibody, catalog no. 70R-5334

A synthetic peptide for use as a blocking control in assays to test for specificity of TLK1 antibody, catalog no. 70R-2084

ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNG1 antibody, catalog no. 70R-5115

Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)

The RAB3A antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cytotoxicity, mitogen-activated protein signaling, and protein synthesis. This antibody specifically targets RAB3A, a small GTPase involved in vesicle trafficking and neurotransmitter release.

A synthetic peptide for use as a blocking control in assays to test for specificity of PEA15 antibody, catalog no. 70R-9630

Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

Ac-Asp-Met-Gln-Asp-H aldehyde is a synthetic peptide that has been shown to inhibit protein interactions with the extracellular domain of the human insulin receptor. It also has been shown to activate the receptor, which leads to increased intracellular calcium levels and increased insulin secretion. Ac-Asp-Met-Gln-Asp-H aldehyde may be used as a research tool for studying protein interactions or as an antibody labeling agent. It is highly pure and can be used in cell biology and life science laboratories.

Rabbit polyclonal Horse Serum Albumin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CHCHD1 antibody, catalog no. 70R-3971

Rabbit polyclonal PAK1/3 antibody (Thr402)

Adavivint is a genetically engineered human TNF-α protein. It is a recombinant human tumor necrosis factor alpha (TNF-α) that has been modified to be less immunogenic. Adavivint is not active in the absence of other growth factors and cytokines, but can activate cells in vitro to produce proinflammatory cytokines such as IL-1β, IL-6, IL-8, and IL-12. This protein also activates cell factor and other signaling pathways that lead to the release of intracellular stores of inflammatory molecules. The effective dose for Adavivint is still being determined in clinical trials.

RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

C4BPA antibody was raised in Rabbit using Human C4BPA as the immunogen

ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Affinity purified Rabbit polyclonal GRASP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1C2 antibody, catalog no. 70R-4046

Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.

ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE

A synthetic peptide for use as a blocking control in assays to test for specificity of PSG1 antibody, catalog no. 70R-1590

A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS11D antibody, catalog no. 70R-1893

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM108 antibody, catalog no. 70R-1305

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A6 antibody, catalog no. 70R-6466

A synthetic peptide for use as a blocking control in assays to test for specificity of USP15 antibody, catalog no. 70R-9736

GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD

A synthetic peptide for use as a blocking control in assays to test for specificity of HRK antibody, catalog no. 70R-6345

1-347 amino acids: MGSSHHHHHH SSGLVPRGSH MRVVVIGAGV IGLSTALCIH ERYHSVLQPL DIKVYADRFT PLTTTDVAAG LWQPYLSDPN NPQEADWSQQ TFDYLLSHVH SPNAENLGLF LISGYNLFHE AIPDPSWKDT VLGFRKLTPR ELDMFPDYGY GWFHTSLILE GKNYLQWLTE RLTERGVKFF QRKVESFEEV AREGADVIVN CTGVWAGALQ RDPLLQPGRG QIMKVDAPWM KHFILTHDPE RGIYNSPYII PGTQTVTLGG IFQLGNWSEL NNIQDHNTIW EGCCRLEPTL KNARIIGERT GFRPVRPQIR LEREQLRTGP SNTEVIHNYG HGGYGLTIHW GCALEAAKLF GRILEEKKLS RMPPSHL

Rabbit polyclonal CLCN6 antibody

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10210

The STIP1 antibody is a monoclonal antibody that has a stimulatory effect on various biological processes in the Life Sciences field. It specifically targets lectins and autoantibodies, and has been extensively studied for its potential therapeutic applications. This antibody is designed to bind to specific epitopes on the target protein, leading to modulation of various cellular pathways.

GSK143 is a peptide that activates an antibody and receptor to induce cell death. It has been shown to be a potent inhibitor of ion channels, including calcium channels and potassium channels. GSK143 also interacts with a variety of proteins in the cell, such as ligands and receptors, which may be used to study receptor-ligand interactions. GSK143 is soluble in water and has a purity of > 99% (HPLC).

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZ3 antibody, catalog no. 70R-4845

A synthetic peptide for use as a blocking control in assays to test for specificity of CDKL5 antibody, catalog no. 70R-9937

A synthetic peptide for use as a blocking control in assays to test for specificity of MPPE1 antibody, catalog no. 70R-7157

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCD2 antibody, catalog no. 70R-6717

A synthetic peptide for use as a blocking control in assays to test for specificity of GPI antibody, catalog no. 70R-10234

ELISA kit for the detection of NGAL in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of RBMY1A1 antibody, catalog no. 70R-4807

Donkey anti Goat IgG (H + L) secondary antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC4 antibody, catalog no. 70R-2117

A synthetic peptide for use as a blocking control in assays to test for specificity of Shc3 antibody, catalog no. 70R-9462

Rabbit polyclonal PPPDE1 antibody

APLF antibody was raised in Rabbit using Human APLF as the immunogen

IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.

Rabbit polyclonal IKBB antibody (Ser23)

Human sequence expressed in NS0 Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

CHRNA3 antibody was raised in rabbit using the N terminal of CHRNA3 as the immunogen

Redd1 is a transcriptional regulator that functions as a negative regulator of inflammation. Redd1 induces the expression of IL-12 in human monocytes, which can lead to the suppression of inflammatory responses. Redd1 also inhibits the development of regulatory T cells and Th17 cells, which are important for maintaining immune tolerance. Redd1 is induced by microbial products and the pathogen Toxoplasma gondii, but it is overridden by IL-12 in the presence of this cytokine. The induction of Redd1 is mediated by IL-12 through activation of STAT3 transcription factor.
!--END-->

Rabbit polyclonal VTI1A antibody

Rabbit polyclonal TAOK2 antibody

The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.

AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

A synthetic peptide for use as a blocking control in assays to test for specificity of PABPC1L2A antibody, catalog no. 70R-4937

Purified Polyclonal RNF130 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Ghitm antibody, catalog no. 70R-8666

CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen

Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal CKI alpha antibody

This product is a protein A purified mouse monoclonal antibody with clones of the immunoglobulin subclasses: IgG1 and IgG2a available. These clones recognise human D-Dimer and high molecular weight fibrin degradation products and no cross-reactions is observed with fibrinogen and D-monomer. A potential application of this product is for coating to latex particles for latex enhanced immunoturbidimetric applications. It can further be used in ELISA and immunofluorescent assays.
Human D-dimer, a soluble fibrin degradation product recognised by this antibody product, can be used as a marker for clinical conditions where the process of coagulation and fibrinolysis have been activated. For example it can be used in the diagnosis of venous thromboembolism and intravascular coagulation. The formation of human D-dimer occurs when fibrinogen is converted to fibrin monomers when the enzyme thrombin cleaves fibrinopeptides at the N-terminal domain of fibrinogen. These monomers aggregate when interacting with another enzyme: activated factor XIII (factor XIIIa) forming a cross-linked fibrin polymer, also known as a fibrin clot. A final enzyme, plasmin, degrades this fibrin clot, resulting in D-dimer. It is important to note that when applying this product clinically, levels of D-dimer can be influenced by human factors such as age, pregnancy and cancer.

A synthetic peptide for use as a blocking control in assays to test for specificity of ADH4 antibody, catalog no. 70R-2378

Affinity purified Rabbit polyclonal Tetraspan 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GH2 antibody, catalog no. 70R-1713

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A2 antibody, catalog no. 70R-6773

Purified Polyclonal ADRB2 antibody

ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.

Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Purified recombinant Human MANF Protein (His tag)

Purified native Ectromelia virus protein (Mouse)

A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;

HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

A synthetic peptide for use as a blocking control in assays to test for specificity of STK3 antibody, catalog no. 70R-1658

A synthetic peptide for use as a blocking control in assays to test for specificity of Pde4d antibody, catalog no. 70R-9419

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB1 antibody, catalog no. 70R-2340

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD2 antibody, catalog no. 70R-8954

Affinity purified Rabbit polyclonal NDUFA1 antibody