Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of Med19 antibody, catalog no. 70R-9337

The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.

The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.

Affinity purified Rabbit polyclonal COPD antibody

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

Jasplakinolide is a cyclodepsipeptide, which is isolated from marine sponge species, particularly of the genus Jaspis. It functions by binding to actin, a critical component of cellular cytoskeletons, where it induces polymerization and stabilization of actin filaments. This action results in the disruption of normal actin dynamics, impeding processes such as cell motility and division.

MAGEA10 antibody was raised in Rabbit using Human MAGEA10 as the immunogen

Rabbit polyclonal TLP11 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf54 antibody, catalog no. 70R-3576

A synthetic peptide for use as a blocking control in assays to test for specificity of CABP4 antibody, catalog no. 70R-9895

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF154 antibody, catalog no. 70R-8772

A synthetic peptide for use as a blocking control in assays to test for specificity of NEK11 antibody, catalog no. 70R-2292

A synthetic peptide for use as a blocking control in assays to test for specificity of PDCD7 antibody, catalog no. 70R-6011

ELISA Kit for detection of MMP2 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of TFAP2C antibody, catalog no. 70R-7988

A synthetic peptide for use as a blocking control in assays to test for specificity of Il5 antibody, catalog no. 70R-9263

A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL1 antibody, catalog no. 70R-7382

DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.

A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf154 antibody, catalog no. 70R-4442

A synthetic peptide for use as a blocking control in assays to test for specificity of UTP14A antibody, catalog no. 70R-4460

A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4503

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF382 antibody, catalog no. 20R-1228

A synthetic peptide for use as a blocking control in assays to test for specificity of ALAS2 antibody, catalog no. 70R-2482

ELISA kit for the detection of Cathepsin G in the research laboratory

Goat anti-monkey IgG (FITC) was raised in goat using monkey IgG as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM1 antibody, catalog no. 70R-8515

A synthetic peptide for use as a blocking control in assays to test for specificity of PI3 antibody, catalog no. 70R-7380

The EGF antibody is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for its ability to inhibit the binding of EGF to its receptor, preventing downstream signaling pathways that promote cell proliferation and survival. The EGF antibody can be immobilized on streptavidin-coated surfaces or used in solution-based assays. It has been shown to be cytotoxic towards cells that rely heavily on EGF signaling for their growth and survival. Additionally, this antibody has been used in studies to investigate the role of EGF in various biological processes, such as wound healing and cancer progression. With its high specificity and affinity for EGF, the EGF antibody is an invaluable tool for researchers studying the effects of this growth factor and developing potential therapeutic inhibitors.

HMG20A antibody was raised in Rabbit using Human HMG20A as the immunogen

PBTTT-c12 is a dodecyl unipolar semiconductor that can be used as a material for electronic devices. PBTTT-c12 has low molecular weight, high solubility, and transport properties. This material crystallizes at room temperature and exhibits a hexagonal crystal structure with a lattice constant of 1.8 Å. It is also soluble in organic solvents such as chloroform or acetone. The optical absorption spectrum shows two bands in the visible region: one near 400 nm, which corresponds to the π* orbital; and another at 600 nm, which corresponds to the π* orbital and the σ* orbital. In addition, PBTTT-c12 semiconductors have been shown to exhibit diffraction patterns at low temperatures (below -200°C).

Hh-Ag1.5 is a protein that is expressed in the brain and is thought to be involved in the development of cancer. It has been shown to be involved in dopamine production and may play a role in Parkinson's disease. Hh-Ag1.5 has been found to be overexpressed in cervical cancer cells, which may contribute to their chemoresistance to therapy. This protein also plays a role in the development of dyskinesias, which are abnormal movements that can occur as side effects of levodopa treatment for Parkinson's disease, and carcinogenesis, which is the formation of cancerous cells. Hh-Ag1.5 is activated by kinesin and phosphorylated by casein kinase II (CKII).

Homomazindol is a benzodiazepine that binds to the benzodiazepine receptor, which is found in the central nervous system. It has been shown to have strong affinity for the striatal region of the rat brain, and it can be used as an in vitro assay for ligands. In vivo assays have also shown that homomazindol binds to dopamine receptors, and it has been suggested that this may be related to its anticonvulsant effects. Homomazindol's chemical structure is similar to cocaine, and it has been shown to have similar effects on dopamine release in rat striatal membranes. This drug can exist as two tautomers: one with a hydroxyl group and one without. In addition, homomazindol hydrochloride (HOM) is related to methoxyhomomazindol (MOM), which has been shown to bind more tightly than HOM does.

CER11-2′S(d9) is a peptide that is an inhibitor of protein interactions. It binds to the receptor and activates it. CER11-2′S(d9) can be used as a research tool in cell biology, pharmacology, and other life sciences. It has high purity with a CAS number of 2260670-22-0.

NRC-AN-019 is an imatinib-resistant drug that belongs to the class of bcr-abl inhibitors. It has been shown to be effective in women with metastatic breast cancer and who are resistant to lapatinib and imatinib. NRC-AN-019 is a polymeric matrix that contains epidermal growth factor (EGF) and is designed for topical administration. The drug binds to the receptor tyrosine kinase erbB2, which prevents it from binding with the epidermal growth factor receptor (EGFR). This leads to suppression of cellular proliferation, differentiation, and angiogenesis. NRC-AN-019 also has pharmacokinetic properties that allow for escalation of dosage without significant toxicities or side effects.

Apomorphine is a non-selective dopamine receptor agonist that is used in the treatment of Parkinson's disease. Apomorphine, also known as (R)-apomorphine-d4 hydrochloride, is an activator of G-protein coupled receptors. It has been used to study ion channels and peptides, as well as to identify the binding site for various ligands. Apomorphine has been shown to inhibit the enzymatic activity of protein interactions that are important for cell proliferation and survival, including interactions between receptor tyrosine kinases and their substrates, adhesion proteins, and integrin receptors. This drug also has been shown to decrease the levels of beta amyloid plaques in Alzheimer's disease.

A 331440 Dihydrochloride is a potent and selective NMDA receptor antagonist, which is a synthetic compound with notable binding affinity for modulating excitatory synaptic transmission. This product is derived from chemical synthesis, designed specifically for research applications involving neuronal signaling pathways. Its mode of action involves blocking the ion channels associated with NMDA receptors, thereby inhibiting the flow of calcium ions across the cell membrane.

EBI-3 human is an antibody that inhibits the interaction of peptides and proteins. It can be used as a research tool to study protein interactions, receptor activation, ion channels, and ligands. EBI-3 human has been shown to inhibit the binding of GABA to its receptors and also blocks calcium channels in rat brain cells. The antibody is purified with a high level of purity and has CAS No. 480075-52-3.

Purified Horse IgG (Fab'2)

NPY is a peptide that belongs to the family of neuropeptides. It is an activator of G-protein coupled receptors, which are proteins found on the surface of cells. NPY binds to these receptors and triggers a signal transduction cascade that leads to increased activity in ion channels. This results in an increase in the permeability of the membrane and the influx of calcium ions into cells, which can cause cell death or inhibition of cell growth. NPY has been shown to be involved in many physiological processes, including regulation of food intake, body weight, water balance, reproduction, and immune function. NPY has also been shown to inhibit receptor binding by antibodies.

CTGF protein is a collagen protein that is involved in various cellular processes. It has been shown to interact with liver microsomes and play a role in cell signaling pathways. CTGF protein can be detected using a monoclonal antibody, which specifically targets the protein. This antibody has been used in research studies to investigate the expression and function of CTGF protein. Additionally, CTGF protein has been found to interact with other proteins such as anti-glial fibrillary acidic protein (GFAP) and oncostatin M, suggesting its involvement in different signaling networks. Recombinant forms of CTGF protein are available for use in experiments and can be used as calmodulin inhibitors or nuclear growth factors. The study of CTGF protein is important for understanding its role in various biological processes and its potential implications in diseases such as cancer and fibrosis.

NMB antibody was raised in Rabbit using Human NMB as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS37A antibody, catalog no. 70R-2831

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel6 antibody, catalog no. 70R-5047

Rabbit polyclonal BIK antibody (Thr33)

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf122 antibody, catalog no. 70R-4043

GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Affinity purified Rabbit polyclonal Cryopyrin antibody

K777 is a peptide that binds to the extracellular domain of the receptor for nerve growth factor (NGF), thereby inhibiting the activation of this receptor. K777 is a potent inhibitor of NGF-induced proliferation and differentiation in cultured PC12 cells, probably by preventing the binding of NGF to its receptor. It also inhibits protein interactions with high purity. The K777 hydrochloride is a research tool that can be used to study ion channels and antibody production.

A synthetic peptide for use as a blocking control in assays to test for specificity of DENND1B antibody, catalog no. 70R-7075

Purified Rabbit polyclonal OR5AS1 antibody

Rabbit polyclonal MAP2K1/2 antibody (Ser218,222)

A synthetic peptide for use as a blocking control in assays to test for specificity of TCEAL8 antibody, catalog no. 70R-8874

MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE

Purified Sheep Ig fraction for use as a control or blocking reagent

CD23 antibody was raised in mouse using human peripheral myeloma cells as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494

Affinity purified Rabbit polyclonal Prohibitin 2 antibody

The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.

A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN2 antibody, catalog no. 70R-7314

A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375

The CD62P antibody is a monoclonal antibody that acts as an inhibitor. It has been shown to prevent hemolysis and inhibit the growth factor in adipose tissue. Additionally, this antibody has demonstrated potential in reducing amyloid plaque formation and targeting activated proteins. It also exhibits cytotoxic effects on Mycoplasma genitalium. The CD62P antibody belongs to the group of Monoclonal Antibodies and is effective against autoantibodies, particularly those targeting annexin.

RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Affinity purified Rabbit polyclonal TEAD4 antibody

Please enquire for more information about N,N'-Bis(2,3-dihydroxybenzoyl)-o-L-seryl-L-dehydroalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407

MGAT4C antibody was raised in Rabbit using Human MGAT4C as the immunogen

Purified Goat anti-human Eotaxin polyclonal antibody

The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.

CREB1 antibody was raised in Rabbit using Human CREB1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RSBN1 antibody, catalog no. 70R-3989

Phen-AMC is a potent inhibitor of the enzyme acetylcholinesterase (AChE), which catalyzes the breakdown of the neurotransmitter acetylcholine. Phen-AMC is used as a research tool to study protein interactions, activator, and ligand binding. This inhibitor also has been shown to activate nicotinic receptors, ion channels, and antibodies.

ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen

Beta-Neo-Endorphin is an opioid peptide which binds with high affinity to μ, δ and κ-receptors and has been found to be involved in the modulation of pain, epidermal nerve fiber regulation and skin homeostasis. It is further demonstrated the ability to in human keratinocytes, stimulate wound healing. Beta-neoendorphin is derived from prodynorphin when it is proteolytically cleaved.
This product is available as a 0.5mg vials and is sourced from Porcine.

Rabbit polyclonal AGP2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273

A synthetic peptide for use as a blocking control in assays to test for specificity of MOV10L1 antibody, catalog no. 70R-4743

A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf48 antibody, catalog no. 70R-9334

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2B antibody, catalog no. 70R-4662

Beta-apo-13-carotenone d3 is a fluorescent compound that is used in research as an activator or ligand for receptor binding studies. This product can be used in cell biology, pharmacology, and other life science applications. Beta-apo-13-carotenone d3 has been shown to inhibit ion channels and protein interactions. It also has the ability to activate receptors on cells.

The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.

MMP13-IN-3 is a recombinant peptide that has been shown to activate proteinase 13 (MMP13). It has been shown to inhibit the activation of ion channels, such as voltage-gated potassium channels. This peptide can be used as a research tool in cell biology and pharmacology. MMP13-IN-3 is an inhibitor of the receptor for peptides.

Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K2 antibody, catalog no. 70R-2007

A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 20R-1231

1-440 amino acids: MGSSHLLNKG LPLGVRPPIM NGPLHPRPLV ALLDGRDCTV EMPILKDVAT VAFCDAQSTQ EIHEKVLNEA VGALMYHTIT LTREDLEKFK ALRIIVRIGS GFDNIDIKSA GDLGIAVCNV PAASVEETAD STLCHILNLY RRATWLHQAL REGTRVQSVE QIREVASGAA RIRGETLGII GLGRVGQAVA LRAKAFGFNV LFYDPYLSDG VERALGLQRV STLQDLLFHS DCVTLHCGLN EHNHHLINDF TVKQMRQGAF LVNTARGGLV DEKALAQALK EGRIRGAALD VHESEPFSFS QGPLKDAPNL ICTPHAAWYS EQASIEMREE AAREIRRAIT GRIPDSLKNC VNKDHLTAAT HWASMDPAVV HPELNGAAYR YPPGVVGVAP TGIPAAVEGI VPSAMSLSHG LPPVAHPPHA PSPGQTVKPE ADRDHASDQL