Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.564 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
PLEKHA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHA1 antibody, catalog no. 70R-3873
Degré de pureté :Min. 95%SSR3 antibody
The SSR3 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear receptor GLP-1 and has been widely used in various assays and experiments. The SSR3 antibody is highly specific and exhibits high affinity for its target, making it an ideal tool for studying the functions of GLP-1. This antibody has been successfully used in experiments involving electrode-based techniques, such as patch-clamp recordings, as well as in immunoassays to detect GLP-1 levels in human serum samples. Additionally, the SSR3 antibody has shown efficacy in cytotoxicity assays and has been used to study the effects of GLP-1 on cell growth and survival. Its versatility and reliability make it a valuable tool for researchers working in the field of Life Sciences.
B4GALT3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of B4GALT3 antibody, catalog no. 70R-7307
Degré de pureté :Min. 95%VASP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VASP antibody, catalog no. 70R-10268
Degré de pureté :Min. 95%RSV antibody
RSV antibody was raised in rabbit using Residues 81-95 [LESYIGSINNITKQSA] of the human RSV M2 protein as the immunogen.Degré de pureté :Min. 95%GGN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GGN antibody, catalog no. 70R-2174
Degré de pureté :Min. 95%TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Degré de pureté :Min. 95%RBP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBP4 antibody, catalog no. 70R-5457
Degré de pureté :Min. 95%SOCS7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SOCS7 antibody, catalog no. 70R-5835
Degré de pureté :Min. 95%Leucine zipper protein 1 antibody
Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody
C6ORF64 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf64 antibody, catalog no. 70R-6964
Degré de pureté :Min. 95%KCNN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNN3 antibody, catalog no. 70R-1524
Degré de pureté :Min. 95%SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
CRISP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CRISP1 antibody, catalog no. 70R-5306
Degré de pureté :Min. 95%PFAS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PFAS antibody, catalog no. 70R-2690
Degré de pureté :Min. 95%NOL4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOL4 antibody, catalog no. 70R-4720
Degré de pureté :Min. 95%PNMA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA3 antibody, catalog no. 70R-2050
Degré de pureté :Min. 95%IGF2BP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IGF2BP1 antibody, catalog no. 70R-4908
Degré de pureté :Min. 95%PF4V1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PF4V1 antibody, catalog no. 70R-5912
Degré de pureté :Min. 95%Urgcp Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Urgcp antibody, catalog no. 70R-9383
Degré de pureté :Min. 95%EED antibody
The EED antibody is a highly specialized and potent anti-mesothelin antibody that is widely used in Life Sciences research. It has the ability to bind specifically to mesothelin, a protein that is involved in cell growth and signaling pathways. This antibody is commonly used in studies related to growth factors, chemokines, and other important biological processes. Additionally, the EED antibody has been shown to have neutralizing properties against mesothelin, making it an ideal tool for studying the effects of this protein in various experimental settings. It can be used in a variety of applications including immunohistochemistry, Western blotting, ELISA, and more. With its high specificity and affinity for mesothelin, the EED antibody provides researchers with a valuable tool for understanding the role of this protein in disease development and progression.
Gnpda1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gnpda1 antibody, catalog no. 70R-8786
Degré de pureté :Min. 95%HNRPA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPA3 antibody, catalog no. 70R-1463
Degré de pureté :Min. 95%ARIH1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARIH1 antibody, catalog no. 70R-1160
Degré de pureté :Min. 95%Neurexophilin 4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NXPH4 antibody, catalog no. 70R-4049
Degré de pureté :Min. 95%SULT2B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SULT2B1 antibody, catalog no. 70R-2606
Degré de pureté :Min. 95%GPX7 antibody
The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.
XTP3TPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-3772
Degré de pureté :Min. 95%CDC45L antibody
The CDC45L antibody is a highly specialized monoclonal antibody that targets the CDC45L protein. This protein plays an important role in various biological processes, including DNA replication and cell cycle regulation. By specifically binding to CDC45L, this antibody can effectively inhibit its function and disrupt these processes.
DDX48 antibody
DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
Netrin 1 antibody
Netrin 1 antibody is a growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets netrin 1, a protein involved in cell migration and axon guidance. This antibody can be used for various applications, including research in the life sciences field.
Human MMP1 ELISA kit
ELISA Kit for detection of MMP1 in the research laboratory
Degré de pureté :Min. 95%APPL1 antibody
APPL1 antibody was raised using the middle region of APPL1 corresponding to a region with amino acids GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD
C5 antibody
The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.
MRE11A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRE11A antibody, catalog no. 70R-9417
Degré de pureté :Min. 95%FAM108B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM108B1 antibody, catalog no. 70R-3168
Degré de pureté :Min. 95%CA5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CA5A antibody, catalog no. 70R-9981
Degré de pureté :Min. 95%IGF1 antibody
The IGF1 antibody is a highly specialized antibody that targets insulin-like growth factor 1 (IGF1). It plays a crucial role in various physiological processes, including cell growth, proliferation, and differentiation. This monoclonal antibody specifically binds to IGF1, inhibiting its activity and preventing it from binding to its receptor.
NKIRAS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NKIRAS1 antibody, catalog no. 70R-5878
Degré de pureté :Min. 95%Rotavirus antibody
Rotavirus antibody was raised in mouse using p42 inner-capsid rotavirus antigen as the immunogen.
DDX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX1 antibody, catalog no. 70R-4821
Degré de pureté :Min. 95%TRPM5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRPM5 antibody, catalog no. 70R-5146
Degré de pureté :Min. 95%MARCKS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MARCKS antibody, catalog no. 70R-10038
Degré de pureté :Min. 95%RNF170 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF170 antibody, catalog no. 70R-6285
Degré de pureté :Min. 95%COL4A6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COL4A6 antibody, catalog no. 70R-9964
Degré de pureté :Min. 95%CFLAR protein
CFLAR protein is a medicament that plays a crucial role in various biological processes. It interacts with β-catenin and E-cadherin, which are essential for cell adhesion and signaling. CFLAR protein has been shown to regulate microvessel density, promoting angiogenesis in certain tissues. Additionally, it has neutralizing effects on epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta), inhibiting their signaling pathways. This protein also contributes to the maintenance of collagen synthesis in adipose tissue.Degré de pureté :Min. 95%SCYE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCYE1 antibody, catalog no. 70R-5898
Degré de pureté :Min. 95%Arginase I antibody
The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.
PEX10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PEX10 antibody, catalog no. 70R-6974
Degré de pureté :Min. 95%CD40L antibody
The CD40L antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize the CD40 ligand, which is involved in various autoimmune and inflammatory diseases. This antibody has been extensively studied for its ability to inhibit the production of autoantibodies, such as antiphospholipid antibodies, and regulate the immune response.
KIAA0319 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0319 antibody, catalog no. 70R-1738
Degré de pureté :Min. 95%AFAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AFAP1 antibody, catalog no. 70R-3533
Degré de pureté :Min. 95%UBAC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBAC2 antibody, catalog no. 70R-6989
Degré de pureté :Min. 95%SCCPDH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCCPDH antibody, catalog no. 70R-9242
Degré de pureté :Min. 95%GJE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJE1 antibody, catalog no. 70R-1698
Degré de pureté :Min. 95%PRMT8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT8 antibody, catalog no. 70R-1263
Degré de pureté :Min. 95%IGSF9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF9 antibody, catalog no. 70R-7213
Degré de pureté :Min. 95%Rheumatoid Factor IgG ELISA Kit
ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory
Degré de pureté :Min. 95%C9ORF43 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf43 antibody, catalog no. 70R-4411
Degré de pureté :Min. 95%KIF22 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF22 antibody, catalog no. 70R-5549
Degré de pureté :Min. 95%OR2C1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2C1 antibody, catalog no. 70R-9858
Degré de pureté :Min. 95%TOM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TOM1 antibody, catalog no. 70R-4061
Degré de pureté :Min. 95%Catalase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CAT antibody, catalog no. 70R-3022
Degré de pureté :Min. 95%MALT1 antibody
The MALT1 antibody is a highly specialized and immobilized antibody that plays a crucial role in various biological processes. It is particularly effective in detecting and targeting the activated form of interferon-gamma (IFN-gamma), which is an essential antigen involved in immune response regulation. Additionally, this antibody has been shown to interact with growth factors and participate in sumoylation, a process that modifies proteins for specific cellular functions.
SLC35A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35A5 antibody, catalog no. 70R-7166
Degré de pureté :Min. 95%ZFP42 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP42 antibody, catalog no. 70R-8160
Degré de pureté :Min. 95%RPLP0 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPLP0 antibody, catalog no. 70R-1442
Degré de pureté :Min. 95%Vimentin protein antibody
The Vimentin protein antibody is a powerful tool for conducting antigen-antibody reactions in various research applications. This antibody specifically targets the vimentin protein, which plays a vital role in maintaining cell structure and integrity. It can be used to study vimentin expression levels, localization, and interactions with other proteins.
BMP2K Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BMP2K antibody, catalog no. 70R-1033
Degré de pureté :Min. 95%TM4SF20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TM4SF20 antibody, catalog no. 70R-6760
Degré de pureté :Min. 95%Crystallin Gamma C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CRYGC antibody, catalog no. 70R-2030
Degré de pureté :Min. 95%CAMK1G Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CAMK1G antibody, catalog no. 70R-4089
Degré de pureté :Min. 95%Clostridium difficile toxin B antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Experience effective treatment for tuberculosis infection with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside. This antituberculosis drug, belonging to the rifamycins class, offers bactericidal activity against Mycobacterium strains. By inhibiting DNA-dependent RNA polymerase, it prevents transcription and replication, effectively inhibiting bacterial growth. With its high frequency of human activity and metabolic transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this active compound ensures optimal results. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment of tuberculosis infections.IGFBP3 antibody
IGFBP3 antibody is a stable chemical compound that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes IGFBP3, which stands for insulin-like growth factor binding protein 3. This antibody has been extensively used in research and diagnostics to study the aberrant methylation and oxidative damage associated with IGFBP3.
TAPBP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAPBP antibody, catalog no. 70R-6000
Degré de pureté :Min. 95%Cortisol 3-CMO-BSA
Cortisol 3-CMO-BSA is a growth-promoting protein that belongs to the class of Proteins and Antigens. It is a molecular modeling compound that has been shown to inhibit protein phosphorylation and metabolism, making it an effective metabolic inhibitor. Cortisol 3-CMO-BSA is commonly used in immunoassays and has been found to have neutralizing properties against fatty acids. Its binding constants with antibodies are high, indicating its strong affinity for binding to specific targets. Additionally, this compound has been shown to promote endothelial growth and mineralization.
