Produits biochimiques et réactifs

MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.

Trofinetide is a neuroprotective compound that acts as an antioxidant. Trofinetide has been shown to reduce oxidative stress and protect against neuronal death in cells. It also has been shown to improve the clinical response in patients with Alzheimer's disease, and may be used for the treatment of other neurodegenerative disorders such as Parkinson's disease. Trofinetide is orally administered and is metabolized by cytochrome P450 enzymes, which makes it a suitable candidate for specific treatments. The pharmacokinetic properties of trofinetide are not well understood due to its short half-life.

(2S,4R)-4-((3-Chloro-7-methoxyquinoxalin-2-yl)oxy)-2-(methoxycarbonyl)pyrrolidinium methanesulfonate is a peptide that can be used as a research tool to study protein interactions and receptor binding. It is an inhibitor of ion channels and ligand for G protein coupled receptors. The purity of this compound is >97%. CAS No. 1425038-20-5

Hemopexin is a glycoprotein that binds to and removes hemoglobin from plasma, thereby preventing the formation of hemosiderin. It has been shown to be an important component in the inflammatory response by binding to complement protein C3b. Hemopexin is also involved in the regulation of lipoprotein metabolism by binding to lipoproteins, such as Apo-E, and o-glycosylation. The glycosylation sites on hemopexin are the same as those found on other glycoproteins, such as transferrin and thrombospondin. Hemopexin's structure is characterized by two types of reactive groups: glcnac residues and fluorescent groups. These groups allow for labeling with various compounds and techniques, such as analytical chemistry or fluorescence spectroscopy.

Huwentoxin XVI is a synthetic molecule that inhibits the transmission of pain signals. It does this by inhibiting the release of neurotransmitters from dorsal root ganglia cells in the spinal cord. Huwentoxin XVI has been shown to inhibit the cancer-associated inflammatory response, which may be due to its ability to inhibit chronic pain. In addition, Huwentoxin XVI has been shown to have an inhibitory effect on adipose tissue and is thought to be a potential treatment for obesity-associated chronic pain. Huwentoxin XVI also blocks A-type potassium channels, which are responsible for neuronal transmission and are found in neurons and glial cells in the dorsal root ganglia. This inhibition can lead to neuropathic pain or chronic pain caused by nerve damage.

JAK2 inhibitor with potential antineoplastic activity

Amino-dPEG®11-ONH-t-boc is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®11-ONH-t-boc is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Amino acids 1-44 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.

Tyrosine hydroxylase antibody was raised in mouse using mouse monoclonal as the immunogen.

Bifeprunox is a small-molecule drug that blocks the activity of the GABA receptor. It has pharmacological and biological effects in various systems, including inhibition of GABA binding to its receptors, activation of the GABA receptor, modulation of cell proliferation and migration, and modulation of protein interactions. Bifeprunox binds to an allosteric site on the GABA receptor and modulates the binding affinity for GABA at this site. It is used as a research tool for studying neurotransmitter receptors.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Secorapamycin A is a small molecule activator of the protein tyrosine phosphatase-1b (PTP-1B). Secorapamycin A binds to PTP-1B and increases its activity, resulting in inhibition of the nuclear factor kappa B (NF-κB) pathway. Secorapamycin A has been shown to inhibit ion channels, such as potassium channels, and to bind to antibodies. This drug also binds to receptors, including ligand binding domain on the human epidermal growth factor receptor 2 (HER2), which is expressed in some breast cancer cells. Secorapamycin A has also been found to inhibit cell proliferation by inhibiting protein synthesis.

Facade-EPC is an antibody that binds to the extracellular domain of a receptor. It is a Research Tool for Cell Biology, Peptides, Pharmacology, Ligand, and Activator. Facade-EPC has been shown to inhibit ion channels such as potassium channels and sodium channels. It also has affinity for the alpha subunit of voltage-gated calcium channels. This antibody can be used in life science research to study protein interactions or receptor activation.

YF-2 is a chemical substance that has been shown to inhibit the production of alpha-synuclein and other proteins in neuro2a cells. It also inhibits the activity of certain enzymes and reduces the thermal expansion of solanum tuberosum, which is a plant that belongs to the family Solanaceae. YF-2 has been found to be an efficient method for inhibiting chemical reactions in vivo studies involving stent implantation, culture supernatant, fetal heart rate, and cancer. The optical system can detect YF-2 using fluorescent or chemiluminescent methods.

The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.

Oclacitinib Maleate is a small molecule that binds to the receptor, activator of nuclear factor kappa-B ligand (RANKL). Oclacitinib Maleate is an inhibitor of RANKL-induced osteoclast differentiation and activation. It inhibits the activation of NF-κB. Oclacitinib Maleate can be used as a research tool for receptor binding and cellular signal transduction studies. It is also used in cell biology research to study ion channels and ligands.

PAOPA is a tyrosinase inhibitor that has been shown to be a potent and selective competitive inhibitor of tyrosinase. It has been shown to inhibit the dopamine-induced tyrosinase activity in rat striatal membranes. PAOPA also blocks the binding of L-DOPA to its receptor, and inhibits the synthesis of melanin by inhibiting the conversion of DOPA to dopaquinone. The low bioavailability of PAOPA may be due to its poor absorption from the gastrointestinal tract and rapid metabolism in liver. PAOPA is effective when used at doses greater than 10 mg/kg body weight.

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.

Ikk inhibitor XII is a dietary supplement that inhibits the IKK complex, which plays an important role in the inflammatory response. It may also have inhibitory effects on tumor growth and cancer metastasis. Ikk inhibitor XII has been shown to be effective against autoimmune diseases, cancers, and inflammatory diseases such as arthritis. The mechanism of action for Ikk inhibitor XII is not well-understood but it is thought to have an inhibitory effect on receptor activity.

Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.

Rabbit polyclonal VATPase G1 antibody (HRP)

INSC antibody was raised in Rabbit using Human INSC as the immunogen

KC antibody was raised in rabbit using highly pure recombinant murine KC as the immunogen.

Phosphotyrosine antibody was raised in rabbit using Iodoacetylphosphotyrosine-KLH conjugate as the immunogen.

Mouse monoclonal NSMCE2 antibody

(4R)-Dorzolamide is a medicinal compound that acts as an inhibitor of kinases, a class of proteins that play important roles in cellular signaling pathways. This compound has been shown to be effective in inhibiting the growth of cancer cells in Chinese hamster ovary cells and human tumor cell lines. (4R)-Dorzolamide is an analog of other anticancer inhibitors, such as imatinib, and has been shown to induce apoptosis, or programmed cell death, in cancer cells. Additionally, this compound has been found in urine samples from patients receiving treatment for cancer, indicating its potential use as a diagnostic tool for detecting cancer. Overall, (4R)-Dorzolamide shows great promise as a potential anticancer agent with significant therapeutic potential.

Acetyl 06:0 NBD-PE is a peptide that has been shown to inhibit the binding of an antibody to a receptor. Acetyl 06:0 NBD-PE can be used as a research tool for studying protein interactions, and it has been found to be an effective inhibitor of ion channels. Acetyl 06:0 NBD-PE is also a ligand for specific receptors and ion channels. This product is of high purity and has not been shown to have any adverse effects on cell biology or life sciences.

The (rac)-PT2399 is an integrated circuit that functions as an analog/digital delay processor. It is sourced from audio electronics and designed with a focus on low-cost applications where time-based audio effects are needed. The mode of action involves using its internal digital processing capabilities to delay audio signals, typically in the range of 30 to 340 milliseconds. This is achieved by sampling the input audio signal, converting it into a digital format, processing the delay, and then reverting it back to an analog output.

Substitution Functional Group:-NH-CO-CH2-CH2-COOHTentaGel; is a gelatinous resin, an important support for solid phase synthesis. TentaGel; resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. TentaGel; HL (High Load) (mean particle size 110 μm: capacity 04-06 meq/g)

CCK-33 is a peptide that was originally isolated from porcine brain. It has been shown to be an activator of ion channels, a ligand for receptors, and an inhibitor of protein interactions. CCK-33 is also a pharmacological tool that can be used to study the role of ion channels in cellular processes such as neurotransmission and cell proliferation. CCK-33 is a receptor antagonist, which means it binds to the receptor and blocks the binding site. This prevents other compounds from binding to the receptor and activating it, thereby blocking its effects.

Mal(12.1) is a peptide that can act as an activator of ion channels, such as calcium channels. It is a potent inhibitor of protein interactions, and has been shown to be a ligand for the GABA receptor. Mal(12.1) also interacts with the GABAA receptor and is able to induce chloride efflux in cells. The chemical name for Mal(12.1) is 3-amino-2,3-dihydrobenzo[1,4]dioxine-6-carboxamide.

ELISA Kit for detection of CEA in the research laboratory

LDN-57444 is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) and inhibits its activation. LDN-57444 is being developed for the treatment of squamous cell carcinoma, which is a type of skin cancer. The drug has been shown to inhibit tumor growth in animal models by inhibiting body formation, promoting autophagy, and reducing mitochondrial membrane potential. LDN-57444 has also been shown to inhibit the proliferation of human cancer cells in vitro and decrease cardiac arrhythmias. LDN-57444 binds to EGFR with a hydroxyl group on its structure that interacts with the EGFR's active site. This binding prevents EGFR from activating downstream signaling pathways, such as those involving phosphatidylinositol 3-kinase (PI3K) and Akt kinase, which are involved in cell proliferation and survival.

Palonosetron is a 5-HT3 receptor antagonist that is used to treat nausea and vomiting caused by chemotherapy. It has a high affinity for the 5-HT3 receptor, but it does not inhibit other serotonin receptors. 6-Oxo-(S,S)-palonosetron is an inhibitor of the enzyme protein interactions that are responsible for the activation of the 5-HT3 receptor. It also binds to the Ligand binding site of the 5-HT3 receptor and blocks signaling to downstream ion channels. Palonosetron has been shown to be an activator of the 5-HT3 receptor in vitro and in vivo. This drug is water soluble with a purity level over 99%. Palonosetron can be used as a research tool or as an antibody reagent.

Suc-Leu-Leu-Val-Tyr-AMC is a peptide that is an activator of ion channels. It can be used to study the effects of ion channel activation on various cells and tissues. Suc-Leu-Leu-Val-Tyr-AMC has also been shown to inhibit ligand binding to some receptors, such as the acetylcholine receptor. This peptide can also be used as a research tool for pharmacology, protein interactions, and antibody production.

Rabbit polyclonal YIPF5 antibody

RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Azoxydapsone is a peptide that belongs to the group of activators. It activates the immune system by activating T-cells and B-cells, as well as stimulating the production of antibodies. Azoxydapsone has been shown to inhibit ion channels and protein interactions.

FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL

Apratastat is a drug that inhibits the production of TNF-α, one of the cytokines responsible for inflammation and tissue damage. Apratastat has been shown to be effective in reducing lung damage caused by exposure to smoke or ozone. It also reduces the inflammatory response in skin diseases such as atopic dermatitis and psoriasis. This drug is administered orally and is excreted unchanged in urine. Apratastat has been shown to have biocompatible properties with a long half-life, which makes it suitable for specific treatment of conditions such as chronic obstructive pulmonary disease (COPD).

Cevidoplenib is a small molecule inhibitor of the receptor tyrosine kinase RET, which is associated with a variety of cancers. It binds to the active site of RET, preventing activation and causing RET to be degraded. Cevidoplenib inhibits the phosphorylation of tyrosine residues on RET, thereby blocking RET-mediated signaling cascades. This inhibition leads to decreased cell proliferation and survival in vitro and in vivo. Cevidoplenib is currently in phase II clinical trials for patients with thyroid cancer or medullary thyroid carcinoma.

Rat monoclonal Granzyme B antibody (biotin)

ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH

TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids TDGSLKNGFPGEETHGLGGEKALETCGAGRSESEVIAEGKAEDVKPEECA

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

FAAH inhibitor 1 is a drug that inhibits the function of fatty acid amide hydrolase (FAAH), an enzyme that breaks down the endocannabinoid anandamide. It is used to treat inflammation, which is caused by pro-inflammatory substances such as cytokines, chemokines, and prostaglandins. FAAH inhibitor 1 is being investigated for its ability to inhibit multidrug resistance in cancer cells. This drug has also been shown to reduce neutrophil recruitment and inflammation in the target tissue. In addition, this drug has been shown to be effective against cyclosporin-resistant neutrophils by inhibiting the function of multidrug resistance protein.

LF 11 is a probiotic that contains live bacteria, which are intended to promote healthy intestinal flora. The bacteria in LF 11 have been shown to inhibit the growth of other bacteria by releasing antimicrobial peptides. These peptides are amphipathic, meaning they can be soluble in both water and oil phases, and they have been shown to have an interactive effect on bacterial vaginosis-causing strains. LF 11 also has antiinflammatory activity, which may be due to its ability to increase insulin-stimulated glucose uptake and reduce fatty acid biosynthesis in adipocytes.

5-Aminomethyl-2-(5-methanesulfonyl-biphenyl-3-sulfonyl)-thiophene is a research tool that can be used in the study of protein interactions. It is an activator and ligand of receptors, which are ion channels that regulate cell functions. It also blocks the activity of potassium channels, which are involved in the regulation of muscle contraction and nerve impulses. 5-Aminomethyl-2-(5-methanesulfonyl-biphenyl-3-sulfonyl)-thiophene is a reagent for use in antibody production, as well as for cell biology studies. This chemical has shown high purity and can be used to examine protein interactions.

PF 06250112 is a drug that binds to the enzyme protein kinase C, which is involved in many cellular processes. It has been shown to be effective in treating hemophilia, proteinuria and glomerulonephritis in animal models. The mechanism of action of PF 06250112 is not yet known, but it is thought to inhibit the transfer of phosphatidylserine from the inner to outer leaflet of the plasma membrane in kidney cells and cause adverse effects on erythematosus. This drug has also been implicated in inhibiting the pathogenesis of this disease by decreasing levels of inflammatory cytokines such as tumor necrosis factor-α (TNF-α).

Rabbit polyclonal RRP8 antibody

Sniper ER-87 is a potent and selective activator of the TRPM2 ion channel. Sniper ER-87 binds to TRPM2 with high affinity, and activates the channel with an EC50 of 0.4 μM in a cell-based assay. Sniper ER-87 is also able to inhibit activation of the TRPM2 ion channel by cold stimuli. The antibody can be used as a research tool for studying TRPM2 protein interactions, as well as pharmacological studies on TRPM2 ligands.

CDDO Im is a natural compound that has potent antitumor activity and anti-inflammatory properties. CDDO Im may also be useful in the treatment of inflammatory bowel disease by inhibiting the production of chemokines and inducing apoptosis in colonic epithelial cells. It inhibits the activation of NF-κB, which is a transcription factor that regulates the expression of many genes involved in inflammation, including cytokines and adhesion molecules. CDDO Im also inhibits epidermal growth factor (EGF) signaling and cell proliferation. This compound can also induce apoptosis via reactive oxygen species. CDDO Im has been shown to inhibit the lps-induced inflammatory response by decreasing pro-inflammatory cytokine levels and preventing neutrophil infiltration into the gut mucosa.

5,8-Dioxo-6-(pyridin-3-ylamino)-5,8-dihydronaphthalene-1-sulfonamide is a research tool that is an activator of the potassium ion channel. It has been shown to be an inhibitor of the calcium ion channel. The chemical structure of 5,8-Dioxo-6-(pyridin-3-ylamino)-5,8-dihydronaphthalene-1-sulfonamide is similar to that of known receptor ligands. 5,8-Dioxo-6-(pyridin-3-ylamino)-5,8 -dihydronaphthalene 1 sulfonamide binds to cell surface receptors and alters their activity. This compound is being investigated for its potential use in treating heart disease and stroke.

Sheep anti-Rabbit Albumin Polyclonal

4-(4-(((6-Methoxy-2-(2-methoxyimidazo[2,1-b][1,3,4]thiadiazol-6-yl)benzofuran-4-yl)oxy)methyl)thiazol-2-yl)-N,N-dimethylbenzamide is a potent and selective inhibitor of the inducible nitric oxide synthase (iNOS). This compound binds to the active site of the enzyme and blocks electron transfer from NADPH to oxygen. 4-(4-(((6-Methoxy-2-(2-methoxyimidazo[2,1-b][1,3,4]thiadiazol-6-yl)benzofuran-4-) oxy)methyl)thiazol-- 2 -yl)-N,N -dimethylbenzamide has been shown to inhibit iNOS with IC50

Inhibitor of fatty acid amide hydrolase

The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.

Rabbit polyclonal TRPS1 antibody

Inhibitor of cyclin-dependent kinases CDK2, CDK7 and CDK9

Prostaglandin A6 is a lipid mediator that is involved in the regulation of many physiological and pathological processes. It has been shown to inhibit the activity of ion channels, increase the permeability of cell membranes, and activate G protein-coupled receptors. Prostaglandin A6 has been extensively used as an inhibitor in research tools for studying cell biology, peptides, pharmacology, ligand binding, and protein interactions. In addition, prostaglandin A6 is a potent activator of G protein-coupled receptors that are found in cardiovascular tissues. This compound also inhibits platelet aggregation and activates vasodilatory pathways.

ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

3,4,5-Trihydroxycinnamic acid decyl ester is a cell-permeable and potent inhibitor of protein interactions. It has been shown to inhibit the activity of ligands such as ATP, ADP, and AMP. 3,4,5-Trihydroxycinnamic acid decyl ester can also be used as an activator for some receptors including cholinergic receptors and histamine H1 receptors. 3,4,5-Trihydroxycinnamic acid decyl ester is a high purity research tool that can be used in ion channel research. This compound has been used in antibody production studies.

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

The spontaneous death of cells is a ubiquitous phenomenon in living organisms. Cell death is an important biological process that occurs in many diseases and conditions, including cancer. The cell death process can be monitored by using fluorescent probes to detect the DNA damage resulting from ionizing radiation or chemotherapeutic drugs. Cells are manually lysed and then subjected to high-throughput analysis using a microarray. Fluorescent probes can also be used for detection of apoptotic cells, which are cells programmed to self-destruct due to stress or other factors. Quantigene is a microarray designed for the simultaneous detection of changes in gene expression as well as phosphatase activity, two key events in apoptosis. Quantigene has been used to study how women respond to radiotherapy and chemotherapy treatments for breast cancer.

INT-767 is a drug that inhibits the activity of toll-like receptor 4 (TLR4). It has been shown to inhibit the synthesis of collagen, which is an important component of fibrosis. INT-767 also counteracts some pharmacological treatments used in the treatment of metabolic disorders, such as diabetes and obesity. This drug selectively blocks TLR4 signaling pathways involved in inflammation, thereby inhibiting the production of cytokines and chemokines. INT-767 has been shown to reduce hepatic steatosis by reducing fat accumulation and decreasing levels of fatty acids in liver cells. In vitro studies have shown that INT-767 reduces cell proliferation and induces apoptosis by increasing expression of proteins involved in this process.

Rabbit polyclonal STX11 antibody

CDK 4/6 Inhibitor-D6 is a monoclonal antibody that inhibits the activity of CDK4 and CDK6, which are key enzymes in the cell cycle that regulate the progression from G1 to S phase. This drug has been shown to inhibit tumor growth in xenograft tumor models. It has also been shown to induce apoptosis in cancer cells by inhibiting the methyltransferase activity of EZH2. The pharmacokinetic properties of this drug have been characterized in a multivariate logistic regression model, and it may serve as a potential biomarker for prostate cancer treatment.

Isoleucyl-Seryl-Bradykinin is a peptide that activates the bradykinin receptor, which is involved in pain sensation and inflammation. This compound is a potent inhibitor of ion channels and also interacts with protein receptors. Isoleucyl-Seryl-Bradykinin has been used as a research tool for studying the function of bradykinin receptors, as well as for pharmacological studies. The CAS number for this product is 86030-63-9.

Custom research peptide; min purity 95%.

Mouse monoclonal CD45.2 antibody (PE)

D9 is a monoclonal antibody that binds to the extracellular domain of the receptor for interleukin-2 (IL-2). It is used in research and development as an experimental drug candidate for the treatment of cancer. The binding of D9 to IL-2 prevents its interaction with IL-2 receptor and blocks IL-2 mediated signaling pathways, inhibiting the proliferation of cancer cells. D9 has also been shown to inhibit the production of monoamine neurotransmitters by binding to transcription factors. Small molecules such as D9 are often synthesized using chemical methods. These methods are typically carried out under acidic conditions, which may not be compatible with sensitive biological systems. It is also possible that D9 may be produced using recombinant methods or through fermentation.
D9 has been shown to have antimicrobial activity against various bacteria including methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis, although it

This antibody reacts with heavy chains on human IgG (gamma chain).

Roscovitine is a ligand that binds to voltage-gated potassium channels. It has been shown to inhibit the function of these channels, which are involved in the regulation of neuronal excitability and muscle contraction. Roscovitine is used as a research tool in pharmacology and cell biology, and can be used as a high purity reagent for antibody production.

Rp-8-Br-PET-cGMPS is a cytosolic calcium analog that inhibits the production of cyclic GMP and has been shown to be an effective anticancer agent. It binds to the camp receptor, which is found in high concentrations in cancer cells, and blocks the uptake of cAMP by inhibiting the adenosine 3 receptor. Rp-8-Br-PET-cGMPS also inhibits the activity of mt2 receptors, which are responsible for the release of Ca2+ from intracellular stores into the cytoplasm. This inhibition limits Ca2+ uptake by the mitochondria and decreases ATP production, leading to cell death. The 8-Br group confers solubility in organic solvents, making this compound more amenable to drug development.

Ns-3-008 hydrochloride is a synthetic research compound, which is derived from laboratory-based chemical synthesis. It acts primarily as an inhibitor of specific biological targets, potentially interfering with cellular signaling pathways. The mode of action of Ns-3-008 hydrochloride often involves binding to and inhibiting key enzymes or receptors that play critical roles in disease-related processes.

Isoxazole class pan-BET family inhibitor

The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.

Sheep polyclonal 17b Estradiol 6 antibody

Rat monoclonal CD150 antibody (biotin)

The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.

Mouse monoclonal CD34 antibody (PE)

Mouse monoclonal NUDT6 antibody

LX7101 is a potent, selective, and orally bioavailable tyrosine kinase inhibitor. It inhibits the proliferation of endothelial cells (ECs) in vitro and the growth of EC-derived tumors in vivo. In both cell culture and animal models, LX7101 potently inhibits phosphodiesterase type-5 (PDE5), which is an enzyme that catalyzes the hydrolysis of cyclic guanosine monophosphate (cGMP). Inhibition of PDE5 leads to increased cGMP levels and has been shown to have therapeutic potential for the treatment of erectile dysfunction. LX7101 also blocks tyrosine kinases, which are enzymes that transmit signals from outside the cell to inside the cell. It has been shown to inhibit nerve injury in rats with peripheral nerve injury. The safety profile of LX7101 has been evaluated by toxicological studies in Sprague-Dawley rats and by clinical development in patients with cancer or cavernosal

RVT 501 is a biochemical reagent, which is derived from synthetic organic compounds with high specificity. Its primary mode of action involves the modulation of cellular oxygenation pathways, impacting the activity of specific intracellular enzymes. By interacting with these molecular targets, RVT 501 effectively alters oxidative stress responses, making it invaluable for experimental protocols focused on redox biology and related fields.