Produits biochimiques et réactifs

DMC1 antibody was raised in Rabbit using Human DMC1 as the immunogen

PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.

NCT-506 is a peptide inhibitor with an IC50 of 2.5 nM, which was designed to mimic the amino acid sequence of the binding site for the erythropoietin receptor. NCT-506 is a potent and selective small molecule inhibitor of erythropoietin (EPO) receptor signaling, without any detectable effect on other protein interactions. This antibody is useful in cell biology research as well as in pharmacology and cell biology studies involving EPO receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of PAPOLG antibody, catalog no. 70R-4710

Purified recombinant Human CLEC2B protein (His tag)

Phyllostine is an epoxide that is produced naturally by marine algal species. It has been shown to inhibit the biosynthesis of cyclic peptides, which are a class of organic chemical compounds. Phyllostine also inhibits the production of hydroxy groups on the surface of cells in plants and fungi. It has been found to be a potent control agent for environmental pollution and has been used as an endophyte-based herbicide in subtilis, which is a strain of bacteria. Phyllostine has also been shown to have activity against endophytic fungus, such as Aspergillus niger, by inhibiting the production of acetate extract from this type of fungus.

Colestipol is a bile acid sequestrant, which is a type of polymeric anion-exchange resin derived from a synthetic, non-absorbable source. Its mode of action involves binding bile acids in the intestine, thereby interrupting their enterohepatic circulation. This binding process forms an insoluble complex that is excreted in feces, reducing the bile acid pool and prompting the liver to use circulating cholesterol to synthesize new bile acids. Consequently, this results in a decrease in serum cholesterol levels.Colestipol is primarily used in the management of hypercholesterolemia, particularly in patients who cannot tolerate statins or require additional cholesterol-lowering support. Its applications extend to both primary and secondary prevention of coronary artery disease due to its role in lowering low-density lipoprotein (LDL) cholesterol levels. While effective, its usage must be carefully monitored due to potential gastrointestinal side effects and possible interactions with the absorption of other medications and nutrients.

CNP-53 is a Research Tool for the study of protein interactions, pharmacology and cell biology. It is an activator that interacts with Ligand Receptor and Cell Biology. CNP-53 is a peptide with a molecular weight of 5310.1 Da, which is purified to be 99% pure. This product is suitable for use in research as well as in clinical trials and has been shown to inhibit ion channels and high purity proteins.

A synthetic peptide for use as a blocking control in assays to test for specificity of FCN2 antibody, catalog no. 70R-7066

Cipropride is a potent, selective, and reversible inhibitor of cAMP-dependent protein kinase. It has been used as a research tool to study protein-protein interactions and is also an activator of phospholipase C. CAS No. 66183-70-8

Rabbit polyclonal CCL5 antibody (HRP)

Inhibitor of casein kinase 1

A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-8787

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC33A1 antibody, catalog no. 70R-6798

KPI-10 is a new fluoroquinolone antibiotic with potent bactericidal activity against gram-negative organisms. KPI-10 has been shown to be active against clinical isolates of Acinetobacter baumannii, Enterobacter aerogenes, Klebsiella pneumoniae, Pseudomonas aeruginosa and Serratia marcescens. This drug also has in vitro activity against Haemophilus influenzae and Moraxella catarrhalis. Due to the safety profile of KPI-10, it is an attractive candidate for treatment of infectious diseases including those caused by gram-negative bacteria.

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4A22 antibody, catalog no. 70R-6524

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC4 antibody, catalog no. 70R-4333

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1754L antibody, catalog no. 70R-6821

NDUFS8 antibody was raised in rabbit using the C terminal of NDUFS8 as the immunogen

Rabbit polyclonal RPH3A antibody (ser234)

Light chain of the bevacizumab monoclonal antibody, sold as the antitumour therapeutic Avastin. It prevents vascular endothelial growth factor (VEGF) from binding to VEGF receptors 1 and 2 thus inhibiting angiogenesis in tumours.

AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

KGF Human is a peptide that belongs to the group of activators. It is a heparin-binding growth factor that belongs to the TGF-β family. KGF Human stimulates cell proliferation, differentiation, and survival in vitro. The binding of KGF Human to its receptor inhibits the activity of ion channels and ligand-gated ion channels, which are involved in the transmission of nerve impulses. KGF Human has been shown to have anti-inflammatory effects in vivo. This peptide can activate erythropoietin production from cultured human erythroleukemia cells and stimulate osteoblast differentiation from human bone marrow stromal cells.

DNMT3L antibody was raised in Rabbit using Human DNMT3L as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of LONRF3 antibody, catalog no. 70R-2808

A synthetic peptide for use as a blocking control in assays to test for specificity of CKMT2 antibody, catalog no. 70R-1093

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH6 antibody, catalog no. 70R-5127

Lanopepden is an antibiotic drug with broad-spectrum antibacterial activity. It is a modified version of the natural product, lanosin A. Lanopepden has been shown to be active against Gram-positive and Gram-negative bacteria, including Enterobacteriaceae and Staphylococcus aureus strains that are resistant to other antibiotics. Lanopepden inhibits bacterial growth by binding to the 50S ribosomal subunit, which leads to inhibition of protein synthesis and cell death. Lanopepden has also been shown to have good skin penetration properties in mice models.

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP4B antibody, catalog no. 70R-6951

Procalcitonin protein is a biomolecule that plays a crucial role in the body's immune response. It is a glycoprotein that is produced in response to bacterial infections and can be used as a diagnostic marker for sepsis. Procalcitonin protein has neutralizing properties and can be targeted by monoclonal antibodies, which are produced by hybridoma cell lines. These monoclonal antibodies specifically bind to procalcitonin protein and can be used for various applications in the field of Life Sciences. Additionally, procalcitonin protein has been found to interact with other molecules such as fibrinogen and chemokines, further highlighting its importance in immune responses. With its potential therapeutic applications, procalcitonin protein holds promise as a target for the development of new medicaments, including DNA vaccines.

A synthetic peptide for use as a blocking control in assays to test for specificity of MCOLN1 antibody, catalog no. 70R-5139

A synthetic peptide for use as a blocking control in assays to test for specificity of Mapk10 antibody, catalog no. 70R-9532

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6748

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2U1 antibody, catalog no. 70R-10392

?-opioid receptor agonist

A synthetic peptide for use as a blocking control in assays to test for specificity of EPB41 antibody, catalog no. 70R-3845

PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

A synthetic peptide for use as a blocking control in assays to test for specificity of QRFPR antibody, catalog no. 70R-10091

740 Y-P is a plant growth regulator, which is a synthetic derivative sourced from alkenyl succinic acid anhydrides. This product acts by modulating plant growth processes through its influence on physiological pathways essential for fruit development and maturation. The mode of action involves the regulation of gibberellin biosynthesis, a key hormone in plant growth, leading to enhanced fruit size, improved coloration, and more uniform ripening.

CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.

Rilmazafone is a peptide that belongs to the class of activators. It has been shown to stimulate antibody production in research animals and may be used as a research tool for studying the function of ion channels and protein interactions. Rilmazafone has also been found to inhibit the activity of receptors, ligands, and ion channels.

Cathelicidin antimicrobial peptide, human, recombinant is a recombinant peptide that has been artificially synthesized. This peptide functions as an antimicrobial to inhibit the growth of bacteria by binding to cellular membranes and disrupting their integrity. Cathelicidin antimicrobial peptide, human, recombinant is expressed in extracellular fluids and functions as chemotaxis and n-terminal signal peptides. The molecular mass of cathelicidin antimicrobial peptide, human, recombinant is 17 kDa. It is active against Escherichia coli, but not against other organisms such as yeast or protozoa. Cathelicidin antimicrobial peptide, human, recombinant also has an inflammatory response in the body (e.g., fever).

This antibody reacts with kappa light chains on human immunoglobulins.

IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD

NSC 162535 disodium is a synthetic compound, classified as a chemical agent. It is derived from chemical synthesis processes intended for research and experimental purposes. The compound acts through biochemical interactions that affect specific cellular pathways, making it of interest for a variety of investigative biological studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF570 antibody, catalog no. 70R-8113

GSK 2334470 is a small molecule that inhibits the activity of the protein kinase CDK4/6. It is a potent inhibitor of tnf-related apoptosis-inducing ligand (TRAIL)-induced cell death and targets amyloid precursor proteins. GSK 2334470 has been shown to suppress the growth of hematopoietic cells in vitro, which may be due to its ability to inhibit cdk4/6 activity. In addition, GSK 2334470 selectively inhibits the kinase activity of CDK4/6 and has no effect on other kinases such as PDK1, cyclin B1, or MAP2K2.

A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6277

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPC4AP antibody, catalog no. 70R-5845

OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

MYOZ2 antibody was raised in Rabbit using Human MYOZ2 as the immunogen

Affinity purified Rabbit polyclonal Lipocalin 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LIM2 antibody, catalog no. 70R-7174

Rasagiline is a research tool that belongs to the class of ligands. It has been shown to activate receptors, such as ion channels and cell biology. Rasagiline has been shown to inhibit ion channels in the brain and thereby reduce the effects of Parkinson's disease. Rasagiline has also been used as an inhibitor for high purity peptides, proteins and antibodies.

16:0 Topfluor cholesterol (16:0-TF) is a fluorescent analog of cholesterol. It is a ligand that binds to the sterol receptor, which is located in the endoplasmic reticulum and plasma membrane. 16:0-TF has been shown to activate ion channels through protein interactions. This compound can be used as a research tool for Cell Biology and other life science applications.

CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.

Glutaminyl-Methionyl-Glutamyl-Glutamyl-Glutamyl-Alanyl-Valyl-Arginine Trifluoroacetate is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF366 antibody, catalog no. 70R-8434

A synthetic peptide for use as a blocking control in assays to test for specificity of ARC antibody, catalog no. 70R-4422

The NRF1 antibody is a powerful tool used in life sciences research. It specifically targets the nuclear respiratory factor 1 (NRF1), a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular energy metabolism and mitochondrial biogenesis. This antibody is highly specific, binding to the carbonyl group of lysine residues on NRF1 with high affinity.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF177 antibody, catalog no. 70R-8251

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH7 antibody, catalog no. 70R-5118

Please enquire for more information about ALS-8112 including the price, delivery time and more detailed product information at the technical inquiry form on this page

EHMT2 antibody was raised in Rabbit using Human EHMT2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of INTS12 antibody, catalog no. 70R-9072

Rabbit polyclonal RRAS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of APOA2 antibody, catalog no. 70R-3980

A synthetic peptide for use as a blocking control in assays to test for specificity of NPFFR2 antibody, catalog no. 70R-9815

Affinity purified Rabbit polyclonal CAPZB antibody

The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC29891 antibody, catalog no. 70R-8990

Lanraplenib succinate is an antibody that can bind to proteins in a cell, thereby inhibiting their function. Lanraplenib succinate is a research tool for the study of cell biology and pharmacology. It is also used as a ligand to activate ion channels and receptors in cells. The antibody has been shown to inhibit the activity of some protein interactions, such as those involved in the regulation of life sciences, or those that lead to protein-protein interactions.

Peptide H-VQDAFAAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.

The SOCS2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated form of the steroid hormone cortisol. This antibody is commonly used in studies investigating the role of cortisol in various biological processes, including growth factor signaling pathways. By blocking the action of cortisol, the SOCS2 antibody can help researchers understand the mechanisms by which this hormone influences cell function and development.

Rabbit polyclonal PAK1/PAK2/PAK3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS3 antibody, catalog no. 70R-1318

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIML2 antibody, catalog no. 70R-4257

JNJ 31020028 is a research tool used in cell biology and pharmacology. It has been shown to bind to the activator protein-1 (AP-1) transcription factor, which regulates proinflammatory cytokines, such as tumor necrosis factor-alpha (TNF-α). JNJ 31020028 inhibits AP-1 activity by binding to the double zinc finger motif of the DNA binding domain and blocking its interaction with DNA. This agent also binds to the TGFβ receptor and blocks TGFβ signaling.

BDTX-189 is a peptide inhibitor of the protein interactions of the β-secretase enzyme that is involved in the processing of amyloid precursor protein (APP) to form amyloid beta (Aβ). It has been shown to be an activator of the Ligand-gated ion channel and a ligand for the nicotinic acetylcholine receptor. BDTX-189 is also used as a research tool in cell biology and biochemistry to study Protein interactions, activation, and inhibition.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDA antibody, catalog no. 70R-10246

Peptide H-VTAPRTLIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ID 8-d3 is a plant growth stimulant, which is derived from lignin, a complex organic polymer found in the cell walls of many plants and algae. With a deep focus on promoting plant growth and resilience, ID 8-d3 functions through the modulation of key plant physiological processes. Its mode of action involves enhancing nutrient uptake, stimulating root development, and bolstering stress resilience, which is mediated by biochemical pathways that synergize with the plant’s inherent metabolic processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf130 antibody, catalog no. 70R-1165

A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2 antibody, catalog no. 70R-8937

Glutamate antagonist

A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf65 antibody, catalog no. 70R-3634

FMF-04-159-2 is a covalent inhibitor of the serine/threonine protein kinase family. FMF-04-159-2 targets the catalytic site of these enzymes, which includes kinases such as p38, JNK, and ERK1/2. The FMF-04-159-2 analog was designed to have a high degree of selectivity for kinases with a hydrophobic active site pocket. FMF-04-159-2 has been shown to inhibit mitosis in cells by targeting mitotic kinases.

Heat shock protein 90 (HSP90) inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of MFSD4 antibody, catalog no. 70R-7527

Affinity purified Rabbit polyclonal BIRC7 antibody