Produits biochimiques et réactifs

Affinity purified Rabbit polyclonal PTPN11 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6495

K777 is a peptide that binds to the extracellular domain of the receptor for nerve growth factor (NGF), thereby inhibiting the activation of this receptor. K777 is a potent inhibitor of NGF-induced proliferation and differentiation in cultured PC12 cells, probably by preventing the binding of NGF to its receptor. It also inhibits protein interactions with high purity. The K777 hydrochloride is a research tool that can be used to study ion channels and antibody production.

A synthetic peptide for use as a blocking control in assays to test for specificity of SPINT2 antibody, catalog no. 70R-9690

A synthetic peptide for use as a blocking control in assays to test for specificity of ME3 antibody, catalog no. 70R-2502

Mouse monoclonal TCR antibody (allophycocyanin)

ELISA kit for the detection of Mouse Resistin in the research laboratory

Affinity purified Rabbit polyclonal Serpina 4 antibody

Affinity purified Rabbit polyclonal Glutathione Peroxidase 2 antibody

GFM1 antibody was raised in Rabbit using Human GFM1 as the immunogen

Affinity purified Rabbit polyclonal ATP2A2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF5 antibody, catalog no. 70R-9592

A synthetic peptide for use as a blocking control in assays to test for specificity of Tgfb3 antibody, catalog no. 70R-8628

SAR-020106 is a small molecule inhibitor that binds to the cell factor, preventing it from binding to its target on cells. SAR-020106 has been shown to inhibit the growth of solid tumours in vitro and in vivo. The mechanism of action is not known, but may be due to inhibition of thymidylate synthesis or induction of apoptosis. SAR-020106 has minimal toxicity and a low potential for drug resistance, which makes it an attractive candidate for cancer therapy. It also appears to be a potential biomarker for anti-cancer drug discovery programs.
SAR-020106 exhibits pharmacokinetic properties that are suitable for oral administration.

Rabbit polyclonal POLM antibody

Beta-apo-13-carotenone d3 is a fluorescent compound that is used in research as an activator or ligand for receptor binding studies. This product can be used in cell biology, pharmacology, and other life science applications. Beta-apo-13-carotenone d3 has been shown to inhibit ion channels and protein interactions. It also has the ability to activate receptors on cells.

ACHE antibody was raised in Rabbit using Human ACHE as the immunogen

ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.

The LCN2 antibody is a highly specialized antibody that targets sclerostin. It is available in both polyclonal and monoclonal forms, offering a wide range of options for researchers. The antibody has been shown to neutralize prorenin and inhibit glucose-6-phosphate activation, making it a valuable tool for studying these processes. Additionally, the LCN2 antibody can be used in various assays and experiments, thanks to its high specificity and affinity for the target antigen. Its activated colloidal gold conjugate allows for easy visualization and detection using techniques such as immunohistochemistry or Western blotting. Researchers can rely on the LCN2 antibody to provide accurate and reliable results in their studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC1 antibody, catalog no. 70R-6981

ARL8B antibody was raised in Rabbit using Human ARL8B as the immunogen

The JNK1 antibody is a highly specialized product used in Life Sciences research. It is designed to neutralize the activity of the growth factor, interleukin-6, in human serum. This antibody specifically targets and binds to the dimers of interleukin-6, preventing their interaction with cell receptors and inhibiting downstream signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of RANGAP1 antibody, catalog no. 70R-5479

A synthetic peptide for use as a blocking control in assays to test for specificity of GOPC antibody, catalog no. 70R-3007

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR1 antibody, catalog no. 70R-2501

Rabbit polyclonal CPXM2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CES2 antibody, catalog no. 70R-3529

A synthetic peptide for use as a blocking control in assays to test for specificity of PNLIP antibody, catalog no. 70R-1583

A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC4 antibody, catalog no. 70R-9378

The L Selectin antibody is a powerful tool for researchers studying actin filaments and protein kinases. This antibody specifically targets L Selectin, a cell surface glycoprotein involved in leukocyte adhesion and migration. By binding to L Selectin, this antibody can inhibit its function and block the interactions between leukocytes and endothelial cells.

2-[(4-Oxo-3-phenyl-5H-pyrimido[5,4-b]indol-2-yl)sulfanyl]-N-phenylacetamide is a synthetic small molecule that was originally designed to be an inhibitor of the α1A subtype of the voltage gated L type calcium channel. It has also been shown to be an activator of the TASK1 potassium channel and have potential as a drug for the treatment of conditions such as stroke. This compound is not currently available commercially but can be synthesized on request.

A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D10C antibody, catalog no. 70R-3441

Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(c) fragment as the immunogen.

Affinity purified Rabbit polyclonal STRA8 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF501 antibody, catalog no. 70R-8992

ACT 178882 is a synthetic peptide that is used to study the interaction of proteins. It binds to Ion channels and inhibits their function, which leads to cell death. The peptide is a potent inhibitor of a number of ion channels, including potassium channels and calcium channels. ACT 178882 has been used as a research tool in the study of protein interactions and as an antibody for immunocytochemistry studies.
ACT 178882 has also been shown to be an activator of the protein kinase C (PKC) family, which can lead to cell death by inhibiting calcium release from intracellular stores.

1-[(4-Methoxyphenyl)methyl]-5-methyl-2,3-dihydro-1H-indole-2,3-dione is a peptide that activates ion channels and inhibits protein interactions. It is used for research purposes as an activator of ion channels and receptor. This peptide has also been identified as a ligand in pharmacology.

Sphingosine-1-phosphate receptor 1 (S1P1) immunomodulator; for MS and psoriasis

2-Oxopropanethioamide is an inhibitor that has shown potential in cancer treatment. It is a Chinese analog of indirubin, a natural compound with anticancer properties. 2-Oxopropanethioamide has been found to inhibit the activity of various kinases, including protein kinase C and cyclin-dependent kinase 2, which are involved in cell growth and division. This inhibition leads to apoptosis or programmed cell death in cancer cells. Studies have shown that 2-Oxopropanethioamide can reduce the growth of tumors in mice and inhibit the proliferation of human cancer cells in vitro. Additionally, this compound has been detected in human urine, making it a promising candidate for further research into cancer therapy.

Antagonist of orexin receptors OX1 and OX2

2-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)amino pyridine-3-sulfonamide is a research tool used in the study of ion channels. It is an inhibitor that binds to the ligand binding site of ion channels and blocks the flow of ions across cell membranes. It has been shown to be a potent activator of voltage gated sodium channels with an EC50 value of less than 10 nM. 2-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)amino pyridine-3-sulfonamide has also been shown to inhibit the production of certain cytokines such as IL2 and IFNγ by inhibiting protein synthesis.

OT-82 is a small-molecule drug that inhibits the HDAC enzyme and has been shown to inhibit cancer growth in vitro and in vivo. It also has anti-inflammatory properties. OT-82 targets myeloid leukemia cells and induces apoptosis through inhibition of histone deacetylases, leading to the activation of proapoptotic proteins, such as Bim and p53. OT-82 is active against pediatric (2 years or younger) chronic lymphocytic leukemia with low expression levels of HDAC1, HDAC2, and HDAC3. In addition, it can be used for the treatment of bone cancer due to its ability to inhibit hdac activity.

KRX 0402 is a methyltransferase inhibitor that competes with the natural substrate, O6-benzylguanine, for binding to the enzyme. KRX 0402 has been shown to inhibit protein synthesis in human leukemia cells and in human cells grown on collagen gels. This drug also has toxicity studies which show it is less toxic than alkylating agents like cyclophosphamide and melphalan. KRX 0402 has been shown to be an effective chemotherapeutic treatment for leukemia cells, because it inhibits DNA synthesis by blocking the activity of key enzymes involved in this process, including topoisomerase II. It may also have an effect on cell growth and differentiation by inhibiting transcription factors such as E2F-1 and stem cell factor (SCF).

Gbr 13069 dihydrochloride is a dopamine/serotonin uptake inhibitor with low potency. It has been shown to inhibit the uptake of dopamine and serotonin, which may be due to its ability to bind to the transporter proteins on the cell membrane. Gbr 13069 dihydrochloride may also have an inhibitory effect on glutamate release and reuptake, as well as on noradrenaline release. These effects are thought to be caused by binding to intracellular receptors in the presynaptic nerve terminal, leading to changes in neurotransmitter release and transport. Gbr 13069 dihydrochloride has also been shown to have an inhibitory effect on autoimmune diseases such as multiple sclerosis and rheumatoid arthritis.

Affinity purified Rabbit polyclonal Integrin alpha X antibody

Phenylmethyl N-[(1S)-1-[[4-(1-naphthalenylcarbonyl)-1-piperazinyl]carbonyl]-5-[(1-oxo-2-propen-1-yl)amino]pentyl]carbamate is a peptide that can be used as a research tool for studying protein interactions such as receptor or ligand. It is also an inhibitor of ion channels and has been shown to have the ability to inhibit the activity of the alpha subunit of voltage gated potassium channels. Phenylmethyl N-[(1S)-1-[[4-(1-naphthalenylcarbonyl)-1-piperazinyl]carbonyl]-5-[(1-oxo-2-propen-1-yl)amino]pentyl]carbamate is a white powder with a purity of 99% or higher in water and DMSO.

CD34 Monoclonal Antibody (FITC)

Armenian Hamster monoclonal CD69 antibody (allophycocyanin)

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT7B antibody, catalog no. 70R-6473

Rabbit polyclonal TNAP1 antibody

The MAD2 antibody is a highly effective active agent that plays a crucial role in regulating cell division. It specifically targets messenger RNA (mRNA) and cell antigens, making it an essential tool in the field of Life Sciences. The MAD2 antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of OR1S1 antibody, catalog no. 70R-9854

Affinity purified Rabbit polyclonal USP47 antibody

FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

A synthetic peptide for use as a blocking control in assays to test for specificity of EDA antibody, catalog no. 70R-5943

CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.5mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.
Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

Benzyl ((2S)-1-(((3-bromo-4,5-dihydroisoxazol-5-yl)methyl)amino)-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)carbamate is a peptide that is used as a research tool for studying protein interactions. It is an inhibitor of ion channels and ligand for GPCRs. This compound has been shown to inhibit the activation of certain ion channels, including the nicotinic acetylcholine receptor, glycine receptor, and 5HT3 receptor. Benzyl ((2S)-1-(((3-bromo-4,5-dihydroisoxazol-5-yl)methyl)amino)-3-(4-hydroxyphenyl)-1-oxopropan-2-)carbamate also binds to receptors such as angiotensin II receptors and mus

The Mouse Leukaemia Virus Protein is a potent inhibitor of family kinases, growth factors, and chemokines. This protein exhibits cytotoxic and nephrotoxic effects and has been shown to interact with CXCR4, hepatocyte growth factor, autoantibodies, superoxide, telomerase, and necrosis factor-related apoptosis-inducing ligand. It can be used in various research applications such as the study of protein-protein interactions, signal transduction pathways, and cellular responses. The Mouse Leukaemia Virus Protein is available as a high-quality monoclonal antibody that has been purified using colloidal techniques. It is suitable for use in experiments involving mesenchymal stem cells or other cell types expressing the target antigen.

Rabbit polyclonal ADCY7 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPA1 antibody, catalog no. 70R-1350

DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of OLR1 antibody, catalog no. 70R-1739

Rabbit polyclonal SLITRK4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHAC1 antibody, catalog no. 70R-6120

Pyr10 is an advanced catalytic agent, which is derived from modified zeolitic materials with high thermal stability and unique structural properties. Its mode of action involves facilitating pyrolytic reactions by providing active sites that enhance the breakdown of complex organic molecules into simpler compounds. This catalytic activity is primarily due to its porous structure and acid-base active centers, which promote efficient molecular interactions during thermal decomposition.

A synthetic peptide for use as a blocking control in assays to test for specificity of SNTG1 antibody, catalog no. 70R-3733

A synthetic peptide for use as a blocking control in assays to test for specificity of ENDOG antibody, catalog no. 70R-5315

Affinity purified Rabbit polyclonal GNAT2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GP2 antibody, catalog no. 70R-6818

3-Methoxychrysene is a carcinogenic compound that has been found in the hexane extract of coal tar. 3-Methoxychrysene is an equilibrating compound, meaning that it can be reversibly converted between its more stable epoxide and less stable phenol forms. The carcinogenic potencies of these two forms are different, with the epoxide form being more potent than the phenol form. 3-Methoxychrysene is metabolized by benzonitrile hydroxylase to yield 3-hydroxybenzaldehyde, which can then undergo nitroreduction to produce benzofuran. This metabolic process is responsible for some of the carcinogenic effects of 3-methoxychrysene.

1-Benzyl-3-(3-dimethylaminopropyloxy)-5-(4-methoxyphenylaminocarbonyl)-1H-pyrazole is a small molecule that has been shown to activate ion channels. This pyrazole derivative binds to and activates the serine/threonine protein phosphatases PP2A, PP2B, and PP2C. The peptide is also a ligand for the serotonin receptor 5HT2A. It can be used as a research tool in cell biology and pharmacology.

Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2465

A synthetic peptide for use as a blocking control in assays to test for specificity of CTPS antibody, catalog no. 70R-1030

A synthetic peptide for use as a blocking control in assays to test for specificity of LIN9 antibody, catalog no. 70R-9005

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC60 antibody, catalog no. 70R-4198

PGM5 antibody was raised in rabbit using the N terminal of PGM5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Pigw antibody, catalog no. 70R-8806

A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA5 antibody, catalog no. 70R-2092

Custom research peptide; min purity 95%.

Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.

HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX19B antibody, catalog no. 70R-1388

RLN3 is a peptide that is used as a research tool for the study of ion channels and protein interactions. It has been shown to act as an inhibitor of Kv1.2, which is an ion channel that regulates potassium ions in cells. RLN3 has also been shown to inhibit the binding of the antibody Herceptin to its receptor, which is important for cancer treatment.
RLN3 belongs to the class of ligands and receptors, which are proteins found on cells that can bind with other proteins or chemicals in order to regulate cellular activity.

N terminal of murine Adipophillin.

PU 23 is a liquid crystal catheter that has been developed for the dynamic measurement of blood flow in large arteries. The device consists of a liquid crystal cavity with a distal sensor and an optical probe that is inserted into the distal end of the cavity. The probe detects changes in luminance, which are transmitted to the sensor. This sensor decodes these changes and transmits them to a data acquisition system or computer to measure flow rate, pressure, and velocity. PU 23 has been used successfully in both animal models and human subjects to measure blood flow in peripheral arteries as well as in coronary arteries.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF651 antibody, catalog no. 20R-1109

NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

A synthetic peptide for use as a blocking control in assays to test for specificity of YPEL5 antibody, catalog no. 70R-9444

Atrial Natriuretic Peptide (ANP) is a hormone that regulates blood pressure and fluid balance. Research has shown that ANP activates the receptor to inhibit the production of cyclic AMP, which is an intracellular second messenger. This process causes the opening of potassium channels, leading to hyperpolarization of the membrane, which decreases the excitability of cells. The ANP Antiserum is used as a research tool for studying the effects of ANP on ion channels and protein interactions in cell biology experiments.

The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.

A synthetic peptide for use as a blocking control in assays to test for specificity of SR140 antibody, catalog no. 70R-4843

A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf67 antibody, catalog no. 70R-4245