Produits biochimiques et réactifs

Affinity purified Rabbit polyclonal LALBA antibody

JUNB antibody was raised in Rabbit using Human JUNB as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PDXP antibody, catalog no. 70R-4378

ApoH antibody (HRP) was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.

The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.

NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Rabbit polyclonal SFN antibody

Rabbit polyclonal POLR3K antibody

CHRNA9 antibody was raised in rabbit using the N terminal of CHRNA9 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of F13B antibody, catalog no. 70R-5445

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1A antibody, catalog no. 70R-3013

A synthetic peptide for use as a blocking control in assays to test for specificity of CDH1 antibody, catalog no. 70R-9719

Gr 55562 dihydrochloride is a chemical compound that interacts with dopamine, serotonin, and norepinephrine receptors. It has been shown to have potent anti-inflammatory properties in animal models of chronic pain. In addition, Gr 55562 dihydrochloride has been shown to be effective in controlling hyperactivity and neuropathic pain in animals. This drug also enhances the effects of other drugs that are used to treat psychostimulant addiction, such as cocaine or amphetamine.

A synthetic peptide for use as a blocking control in assays to test for specificity of NCL antibody, catalog no. 70R-4742

Affinity purified Rabbit polyclonal RBP2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of BRI3BP antibody, catalog no. 70R-7252

A synthetic peptide for use as a blocking control in assays to test for specificity of SPINT2 antibody, catalog no. 70R-7322

Affinity purified Rabbit polyclonal DUSP8 antibody

Mouse monoclonal ZFAND2B antibody

ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE

The Cul4B antibody is a highly specialized and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the Cul4B protein, which plays a crucial role in various cellular processes. The Cul4B protein is involved in the regulation of epidermal growth factor signaling, parathyroid hormone-related protein expression, and chemokine-like activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of LCOR antibody, catalog no. 70R-9910

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEC2 antibody, catalog no. 70R-9923

FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen

The AKR1B10 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets AKR1B10, an enzyme involved in various cellular processes. This antibody offers high photostability and has been extensively tested for its specificity and sensitivity.

A synthetic peptide for use as a blocking control in assays to test for specificity of TST antibody, catalog no. 70R-2439

A synthetic peptide for use as a blocking control in assays to test for specificity of RHBDF1 antibody, catalog no. 70R-6632

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH3 antibody, catalog no. 70R-8070

UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids  TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK

EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

A synthetic peptide for use as a blocking control in assays to test for specificity of PODXL antibody, catalog no. 70R-6251

PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

The p27 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets c-myc, antiphospholipid antibodies, autoantibodies, fibrinogen, superoxide, antibodies, tyrosine, ribosomal binding, alpha-synuclein, Polyclonal Antibodies, collagen, and anticoagulant. This antibody plays a crucial role in various research applications such as immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA).

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652618 antibody, catalog no. 70R-2982

A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D14 antibody, catalog no. 70R-4318

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087

FAF1 antibody is a monoclonal antibody that specifically targets Fas-associated factor 1 (FAF1), a protein found in the nucleus. This antibody has been extensively studied in Life Sciences research and has shown promising results in various assays. It has been shown to effectively bind to and immobilize FAF1, leading to the inhibition of its phosphatase activity. This makes FAF1 antibody a valuable tool for studying the role of FAF1 in cellular processes and signaling pathways.

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

A synthetic peptide for use as a blocking control in assays to test for specificity of HKR1 antibody, catalog no. 20R-1118

Affinity purified Rabbit polyclonal PPID antibody

BAM-12P is a peptide that binds to the extracellular domain of the CXCR4 chemokine receptor. It is an inhibitor of this receptor, and has been shown to inhibit HIV-1 infection in vitro. BAM-12P has also been shown to act as an activator of the CXCR4 receptor in some cell lines, and can be used as a research tool for studying the effects of ligands on receptors. BAM-12P is chemically synthesized with high purity and its CAS number is 75513-71-2. It was isolated from the baculovirus expression system.

The CEBPB antibody is a highly specific antigen-antibody drug that targets actin, a protein involved in various cellular processes. This monoclonal antibody specifically binds to actin filaments in the nucleus, inhibiting their function and disrupting cellular activities. Additionally, this antibody has been shown to reduce microvessel density, indicating its potential as an anti-angiogenic agent.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E3 antibody, catalog no. 70R-2766

DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen

DMP 696 is a peptide that has been shown to have antidepressant-like effects in animal studies and has been evaluated for potential as a drug target for depression. DMP 696 binds to the corticotropin-releasing factor (CRF) receptor, which may be involved in depression, and also has antidepressant-like effects in animals. It also has the potential to be a treatment for heart disease or colorectal distension.

Please enquire for more information about Cryptococcus neoformans Monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

EL-102 is a molecule that has potent inhibition of cancer cells. It inhibits the proliferation of prostate cancer cells by inducing apoptosis and inhibiting angiogenesis. EL-102 is also an inductor in the cell cycle and can be used to detect hypoxic tumor cells. EL-102 is currently in clinical development for its use as an antimicrobial treatment, with light emission as a biomarker for infection. The molecule has been shown to have inhibitory effects on bacteria, fungi, and viruses, such as Herpes simplex virus type 1 (HSV-1).

Horse IgM ELISA Kit

The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.

A synthetic peptide for use as a blocking control in assays to test for specificity of FSTL5 antibody, catalog no. 70R-1991

Affinity purified Rabbit polyclonal TPRKB antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of E130307M08RIK antibody, catalog no. 20R-1150

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4816

ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen

5-HT6 antagonist 29 is a pharmacological compound, which is synthesized through organic chemistry techniques, typically involving multi-step reactions to yield high specificity. This compound functions as a selective antagonist for the 5-HT6 serotonin receptor, a G-protein-coupled receptor predominantly found in the central nervous system.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC391764 antibody, catalog no. 70R-9050

BM152054 is a research tool that binds to the receptor and activates it. It is a ligand that binds to the receptor on the cell surface, which is a protein involved in cell biology. BM152054 has been used for research on ion channels, especially calcium and potassium channels, and their interactions with other proteins. This compound inhibits peptide binding to the receptor by blocking access to the site of attachment. There are many different types of receptors in cells, each specialized in recognizing one type of molecule or another. Receptors are important for cell-cell communication and signaling.

Antiproliferative factor Sialoglycopeptide is a research tool that has been shown to activate the immune system. It has been used as a vaccine carrier and in immunotherapy. Antiproliferative factor Sialoglycopeptide binds to the C-type lectin receptor on erythrocytes, triggering an antibody response. This protein also interacts with ion channels, such as Ca2+ channels, and inhibits protein synthesis by inhibiting the tyrosine kinase activity of protein kinase A (PKA). Antiproliferative factor Sialoglycopeptide is a peptide that is active against many types of cancer cells and has been shown to inhibit tumor growth in mice. The CAS number for Antiproliferative Factor Sialoglycopeptide is 12074-48-2.

Febuxostat is a potent, selective inhibitor of the enzyme xanthine oxidoreductase (XOR). This enzyme is involved in the production of uric acid and its inhibition leads to a decrease in serum uric acid levels. Febuxostat is used for the treatment of chronic gouty arthritis, hyperuricemia associated with primary or secondary causes, and asymptomatic hyperuricemia.
Febuxostat was shown to bind to a number of different receptors and ion channels, including the purinergic receptor P2Y1, ATP-sensitive potassium channel KATP, transient receptor potential ankyrin 1 channel TRPA1 and TRPV1. It also interacts with peptides such as vasopressin V1a receptor antagonist [8] and alpha-2 adrenergic receptor antagonist [9].

ADSS antibody was raised in Rabbit using Human ADSS as the immunogen

Ac-Asp-Asn-Leu-Asp-H (aldehyde) is a peptide that is an agonist of the ion channels. It can be used as a research tool in studies on protein interactions and receptor pharmacology. Ac-Asp-Asn-Leu-Asp-H (aldehyde) binds to the ligand binding site of ion channels, which activates or inhibits their function. This peptide has been shown to inhibit the activity of potassium channels and glutamate receptors, and it can be used as an antibody for cell biology and immunology experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS8 antibody, catalog no. 70R-4537

Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SCARB2 antibody, catalog no. 70R-10351

Rat sequence expressed in sf Insect Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV,  was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2)  in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The CHO derived recombinant protein contains the Coronavirus 2019-Spike Full-Length protein, Wuhan-Hu-1 strain, amino acids 1-1211 having a Mw of 134 kDa fused to His tag at C-terminal. The furin cleavage site (682- 685 a.a.) has been mutated from RRAR to SRAS and the transmembrane domain & intravirion part was replaced with a glycine-serine linker + His-tag. It has been purified by Metal affinity chromatographic technique and the final formulation is avaiable as the CoV-2 spike full length protein solution is supplied in DPBS.

RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen

FOXE3 antibody was raised in Rabbit using Human FOXE3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PARVB antibody, catalog no. 70R-6053

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf111 antibody, catalog no. 70R-4348

CSH2 antibody was raised in Rabbit using Human CSH2 as the immunogen

Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.

A synthetic peptide for use as a blocking control in assays to test for specificity of RNMT antibody, catalog no. 70R-4827

Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf66 antibody, catalog no. 70R-8731

A synthetic peptide for use as a blocking control in assays to test for specificity of GSDML antibody, catalog no. 70R-2356

The TP63 protein is a trifunctional protein that plays a crucial role in various biological processes. It is involved in the regulation of cell proliferation, differentiation, and apoptosis. TP63 has been extensively studied using techniques such as polymerase chain reaction (PCR) and molecular docking.

Mouse sequence expressed in NS0 Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.

Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.

MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM

The DNASE1L3 antibody is a monoclonal antibody that specifically targets DNASE1L3, an enzyme involved in the degradation of DNA. This antibody has high affinity and specificity for DNASE1L3 and can be used as a diagnostic reagent in various research and clinical settings.

A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP19 antibody, catalog no. 70R-4137

BD 3 Human is a recombinant cytokine that has been shown to have a spectrum of activity against gram-positive and gram-negative bacteria, as well as yeast. BD 3 Human is produced by recombinant DNA technology and encodes the amino acid sequence of human interleukin-1 beta (IL-1β). It is a member of the IL-1 family, which includes IL-1α, IL-1β, IL-18, and IL-33. The molecular mass of BD 3 Human is 18 kDa. Cytokines are proteins that regulate cellular activities in response to stimuli from other cells or from the extracellular environment. Recombinant cytokines are produced by microorganisms or cells into which recombinant DNA has been introduced. They are used for research purposes, but not for diagnostic purposes or other therapeutic applications. Reconstitute with sterile water for injection before use. Reconstituted solutions may be stored at 2°C to 8°C

Affinity purified Rabbit polyclonal ITGA1 antibody

The Myc antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor interleukin-6 (IL-6). IL-6 is known to play a crucial role in various biological processes, including cell proliferation and cytotoxicity. By specifically binding to IL-6, the Myc antibody effectively inhibits its activity, preventing excessive cell growth and promoting a balanced cellular environment.

Region of TRAIL Receptor 2 protein corresponding to amino acids MESALITQQD LAPQQRVAPQ QKRSSPSEGL CPPGHHISED GRDCISCKYG QDYSTHWNDL LFCLRCTRCD SGEVELSPCT TTRNTVCQCE EGTFREEDSP EMCRKCRTGC PRGMVKVGDC TPWSDIECVH KES.

SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

4-(Bis-phenylacetic acid) is a synthetic peptide that activates the ion channel TRPV1, which is involved in pain transmission. It has been shown to be a potent inhibitor of protein interactions and may be used as a research tool for the study of protein interactions. 4-(Bis-phenylacetic acid) has been shown to inhibit the activity of ion channels such as TRPV1, TRPM8, and TRPA1.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC100364462 antibody, catalog no. 70R-9134

Endothelin receptor antagonist