Produits biochimiques et réactifs

Scg2 antibody was raised in rabbit using the middle region of Scg2 as the immunogen

FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen

The GPRC5B antibody is a highly specialized protease that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and interacts with the GPRC5B antigen, which is involved in various biological processes. This antibody has been extensively studied for its potential applications in antiviral therapies, high-flux extracellular chemotherapy, and as an inhibitor in certain disease pathways. The GPRC5B antibody is widely recognized for its exceptional specificity and sensitivity, making it an invaluable tool for researchers and scientists working in the field of antibodies and autoantibodies.

CUL3 antibody was raised in Rabbit using Human CUL3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA1 antibody, catalog no. 70R-4832

6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through experiments using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYCP1 antibody, catalog no. 70R-5607

A synthetic peptide for use as a blocking control in assays to test for specificity of MFSD8 antibody, catalog no. 70R-9335

A synthetic peptide for use as a blocking control in assays to test for specificity of MTMR12 antibody, catalog no. 70R-3012

Purified native Dengue Type 3 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of LCP1 antibody, catalog no. 70R-3076

IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD

IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. IL-6 acts as both a pro-inflammatory and anti-inflammatory mediator, playing a crucial role in immune response regulation. The IL6 antibody binds to IL-6 and neutralizes its activity, preventing it from binding to its receptors and initiating downstream signaling pathways.

Affinity purified Rabbit polyclonal Tropomyosin 2 antibody

Bbs1 antibody was raised in rabbit using the N terminal of Bbs1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2U1 antibody, catalog no. 70R-10392

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6748

Procalcitonin protein is a biomolecule that plays a crucial role in the body's immune response. It is a glycoprotein that is produced in response to bacterial infections and can be used as a diagnostic marker for sepsis. Procalcitonin protein has neutralizing properties and can be targeted by monoclonal antibodies, which are produced by hybridoma cell lines. These monoclonal antibodies specifically bind to procalcitonin protein and can be used for various applications in the field of Life Sciences. Additionally, procalcitonin protein has been found to interact with other molecules such as fibrinogen and chemokines, further highlighting its importance in immune responses. With its potential therapeutic applications, procalcitonin protein holds promise as a target for the development of new medicaments, including DNA vaccines.

AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

Light chain of the bevacizumab monoclonal antibody, sold as the antitumour therapeutic Avastin. It prevents vascular endothelial growth factor (VEGF) from binding to VEGF receptors 1 and 2 thus inhibiting angiogenesis in tumours.

The PIK3R2 antibody is a highly specialized growth factor antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies, which are known for their high specificity and sensitivity. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in various cellular processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of HMBS antibody, catalog no. 70R-3585

Purified recombinant Human CLEC2B protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of PAPOLG antibody, catalog no. 70R-4710

PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

DMC1 antibody was raised in Rabbit using Human DMC1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SAMSN1 antibody, catalog no. 70R-1970

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF128 antibody, catalog no. 70R-9681

The GABAB Receptor antibody is a protein-based product that has chromatographic characteristics. It is a neutralizing antibody that targets the angptl3 protein, which is involved in various biological processes such as collagen synthesis and growth factor regulation. This monoclonal antibody specifically binds to the GABAB receptor, an important component of the central nervous system. By targeting this receptor, the antibody can modulate neurotransmission and potentially have therapeutic effects in neurological disorders. The GABAB Receptor antibody is activated upon binding to its target and can induce cytotoxic effects on cells expressing the receptor. Additionally, it may interact with other binding proteins such as epidermal growth factor and hepatocyte growth factor, further expanding its potential applications in research and medicine.

A synthetic peptide for use as a blocking control in assays to test for specificity of JAZF1 antibody, catalog no. 70R-8162

Rat monoclonal CD90.2 antibody (PE)

Goat anti-mouse IgG/IgA/IgM (H+L) was raised in goat using murine IgG, IgA and IgM whole molecules as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of A4GNT antibody, catalog no. 70R-7409

A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 70R-8299

A synthetic peptide for use as a blocking control in assays to test for specificity of CSDC2 antibody, catalog no. 70R-1311

Rabbit polyclonal GRIN1 antibody (Splice Variant C2)

PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

Affinity purified Rabbit polyclonal MLIAP antibody

ELISA Kit for detection of Free Triiodothyronine in the research laboratory

Affinity purified Rabbit polyclonal Laminin beta 3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP9 antibody, catalog no. 70R-4946

A synthetic peptide for use as a blocking control in assays to test for specificity of RPS27A antibody, catalog no. 70R-9769

A synthetic peptide for use as a blocking control in assays to test for specificity of UNC84A antibody, catalog no. 70R-6253

Affinity purified Rabbit polyclonal RFC1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SC5DL antibody, catalog no. 70R-6978

A synthetic peptide for use as a blocking control in assays to test for specificity of PI4KB antibody, catalog no. 70R-3375

A synthetic peptide for use as a blocking control in assays to test for specificity of FSD1L antibody, catalog no. 70R-10113

A synthetic peptide for use as a blocking control in assays to test for specificity of OLFML1 antibody, catalog no. 70R-5401

Affinity purified Rabbit polyclonal RGS17 antibody

The BARHL2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including the regulation of dopamine and nuclear receptor signaling pathways. This antibody has been extensively studied and proven to be effective in blocking the interaction between domperidone and metoclopramide with their respective receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM82 antibody, catalog no. 70R-6672

A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1A1 antibody, catalog no. 70R-4584

A synthetic peptide for use as a blocking control in assays to test for specificity of Anxa6 antibody, catalog no. 20R-1257

NECAP2 antibody was raised in Rabbit using Human NECAP2 as the immunogen

Rabbit polyclonal PGBD3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SARS antibody, catalog no. 70R-1444

A synthetic peptide for use as a blocking control in assays to test for specificity of MITD1 antibody, catalog no. 70R-4506

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC3 antibody, catalog no. 70R-8979

A synthetic peptide for use as a blocking control in assays to test for specificity of NOMO1 antibody, catalog no. 70R-5290

Rat monoclonal CD45R antibody (FITC)

Rabbit polyclonal COMMD4 antibody

The PRDX6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein peroxiredoxin 6 (PRDX6), which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research involving cholinergic signaling, electrode development, and protein kinase studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB26 antibody, catalog no. 70R-5815

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0284 antibody, catalog no. 70R-3488

Affinity purified Rabbit polyclonal PEX26 antibody

CFL1 antibody was raised in Rabbit using Human CFL1 as the immunogen

Affinity purified Rabbit polyclonal IL1F9 antibody

The SYNCRIP antibody is a protein-based product that falls under the category of antibodies. It is specifically designed for use in life sciences research and has potential therapeutic applications. This polyclonal antibody is highly effective in targeting and binding to the SYNCRIP protein, enabling researchers to study its functions and interactions within cells. With its high specificity and sensitivity, this antibody is an invaluable tool for scientists working in various fields such as molecular biology, cell biology, and biochemistry. Whether you are investigating gene expression regulation or studying protein-protein interactions, the SYNCRIP antibody is a reliable choice that will help advance your research efforts.

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZAP1 antibody, catalog no. 70R-4724

The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.

A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_1646157 antibody, catalog no. 70R-9035

DO-11.10 T cell Receptor Monoclonal Antibody (RPE)

A synthetic peptide for use as a blocking control in assays to test for specificity of Cdx1 antibody, catalog no. 70R-8239

Recombinant human MRAS protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10123

A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C75 antibody, catalog no. 70R-6259

A synthetic peptide for use as a blocking control in assays to test for specificity of SAP30BP antibody, catalog no. 20R-1212

A synthetic peptide for use as a blocking control in assays to test for specificity of MSH2 antibody, catalog no. 70R-5689

A synthetic peptide for use as a blocking control in assays to test for specificity of ARSE antibody, catalog no. 70R-7488

A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS3 antibody, catalog no. 70R-3258

DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Rabbit polyclonal ZAP70 antibody (Tyr319)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF714 antibody, catalog no. 70R-9014

A synthetic peptide for use as a blocking control in assays to test for specificity of OR2M2 antibody, catalog no. 70R-9869

TUBB6 antibody was raised in rabbit using the N terminal of TUBB6 as the immunogen

ELISA Kit for detection of PDGFAB in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of S100A9 antibody, catalog no. 70R-5716

A synthetic peptide for use as a blocking control in assays to test for specificity of OR1D2 antibody, catalog no. 70R-9850

IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.

Affinity purified Rabbit polyclonal VATPase a4 antibody

Factor XI antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is specifically designed to target and bind to Factor XI, a growth factor involved in various physiological processes. This antibody can be used in research settings to study the role of Factor XI in insulin signaling pathways, glycosylation processes, and epidermal growth factor regulation.

Rabbit polyclonal Casein kinase 2 antibody