Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.570 produits)
- Par Biological Target(100.766 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(477 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
RAB2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2A antibody, catalog no. 70R-10319
Degré de pureté :Min. 95%IGF2BP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IGF2BP1 antibody, catalog no. 70R-5016
Degré de pureté :Min. 95%BLMH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BLMH antibody, catalog no. 70R-2880
Degré de pureté :Min. 95%SERBP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERBP1 antibody, catalog no. 70R-4696
Degré de pureté :Min. 95%V5 Tag antibody
The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
SOD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SOD2 antibody, catalog no. 70R-5749
Degré de pureté :Min. 95%Mouse BAFF ELISA Kit
ELISA kit for detection of BAFF in the research laboratory
Degré de pureté :Min. 95%HOMEZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HOMEZ antibody, catalog no. 20R-1175
Degré de pureté :Min. 95%ADARB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADARB1 antibody, catalog no. 70R-1550
Degré de pureté :Min. 95%CLN6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLN6 antibody, catalog no. 70R-6316
Degré de pureté :Min. 95%DKK1 antibody
DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%Nkx2.5 antibody
The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.
EML1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EML1 antibody, catalog no. 70R-3550
Degré de pureté :Min. 95%PNKP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNKP antibody, catalog no. 70R-4477
Degré de pureté :Min. 95%Rat PPARa ELISA kit
ELISA Kit for detection of PPARa in the research laboratory
Degré de pureté :Min. 95%EIF4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4B antibody, catalog no. 70R-4927
Degré de pureté :Min. 95%CLCNKB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLCNKB antibody, catalog no. 70R-5147
Degré de pureté :Min. 95%MNS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MNS1 antibody, catalog no. 70R-9486
Degré de pureté :Min. 95%TSSK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSSK2 antibody, catalog no. 70R-2083
Degré de pureté :Min. 95%PCBP2 antibody
The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.
CACNA2D4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA2D4 antibody, catalog no. 70R-9900
Degré de pureté :Min. 95%GAS2L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAS2L1 antibody, catalog no. 70R-5535
Degré de pureté :Min. 95%HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
Human IgG Fc
Human IgG Fc is an immunoglobulin that plays a crucial role in the immune system. It is responsible for neutralizing pathogens and promoting immune responses. Human IgG Fc has been extensively studied for its various functions, including its ability to bind to insulin antibodies and cholinergic receptors. It also interacts with other molecules such as collagen, parathyroid hormone-related protein, and fibronectin, playing a role in cell adhesion and signaling pathways.
Degré de pureté :Min. 95%MPP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPP7 antibody, catalog no. 70R-2195
Pa2g4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pa2g4 antibody, catalog no. 70R-9556
Degré de pureté :Min. 95%SESN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SESN2 antibody, catalog no. 70R-10131
Degré de pureté :Min. 95%CCDC54 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC54 antibody, catalog no. 70R-3303
Degré de pureté :Min. 95%ORAI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ORAI1 antibody, catalog no. 70R-6426
Degré de pureté :Min. 95%Atrazine antibody
The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.
ACTN2 antibody
ACTN2 antibody was raised in rabbit using the C terminal of ACTN2 as the immunogenDegré de pureté :Min. 95%BRF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRF1 antibody, catalog no. 20R-1153
Degré de pureté :Min. 95%RAE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4676
Degré de pureté :Min. 95%MFRP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6525
Degré de pureté :Min. 95%SH3BGRL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BGRL antibody, catalog no. 70R-3848
Degré de pureté :Min. 95%BTBD10 antibody
BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
Rabbit anti Mouse Kappa Chain (biotin)
Rabbit anti-mouse kappa chain (biotin) was raised in rabbit using murine kappa chain as the immunogen.
Degré de pureté :Min. 95%FOXP1 antibody
The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.
EWSR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-8266
Degré de pureté :Min. 95%CYP2E1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2E1 antibody, catalog no. 70R-7499
Degré de pureté :Min. 95%APRIL antibody
The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.
MAOA antibody
MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
TH antibody
The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.
DDIT4L antibody
DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL
VPAC2 antibody
The VPAC2 antibody is a glycoprotein that acts as an endonuclease. It specifically targets and binds to the VPAC2 receptor, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody is commonly used in life sciences research and has applications in fields such as immunology, cancer research, and drug development.
WNT11 antibody
The WNT11 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. This antibody specifically targets the amino group and acts as a growth factor, promoting cellular development and function.
CD44 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD44 antibody, catalog no. 70R-10225
Degré de pureté :Min. 95%PARP16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6277
Degré de pureté :Min. 95%HCG_1745121 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_1745121 antibody, catalog no. 70R-3903
Degré de pureté :Min. 95%HSPA8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA8 antibody, catalog no. 70R-4109
Degré de pureté :Min. 95%GIOT-1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GIOT-1 antibody, catalog no. 20R-1114
Degré de pureté :Min. 95%P2RXL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of P2RXL1 antibody, catalog no. 70R-5141
Degré de pureté :Min. 95%MAD2L1 antibody
MAD2L1 antibody was raised in rabbit using the middle region of MAD2L1 as the immunogen
HPGD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HPGD antibody, catalog no. 70R-10224
Degré de pureté :Min. 95%SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen
Degré de pureté :Min. 95%Estrogen Receptor alpha antibody (Ser106)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)
DDX39 antibody
The DDX39 antibody is a valuable tool used in immunoassays within the Life Sciences field. It specifically targets and binds to isolated nucleic acids, collagen, trastuzumab, and other important molecules. This antibody can be used in both polyclonal and monoclonal forms, allowing for versatile applications in various research settings.
C14ORF130 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf130 antibody, catalog no. 70R-1154
Degré de pureté :Min. 95%hCG protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has demonstrated its high efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, making it highly versatile in combating tuberculosis. With its ability to bind to specific markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.Degré de pureté :≥96% By Sds-Page.SNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431
Degré de pureté :Min. 95%WT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WT1 antibody, catalog no. 70R-8233
Degré de pureté :Min. 95%Dengue Virus IgM ELISA kit
ELISA kit for the detection of Dengue Virus IgM in the research laboratory
Degré de pureté :Min. 95%Cardiotrophin 1 protein
Region of Cardiotrophin 1 protein corresponding to amino acids MSRREGSLED PQTDSSVSLL PHLEAKIRQT HSLAHLLTKY AEQLLQEYVQ LQGDPFGLPS FSPPRLPVAG LSAPAPSHAG LPVHERLRLD AAALAALPPL LDAVCRRQAE LNPRAPRLLR RLEDAARQAR ALGAAVEALL AALGAANRGP RAEPPAATAS AASATGVFPA KVLGLRVCGL YREWLSRTEG DLGQLLPGGS A.
Degré de pureté :Min. 95%MAP4K4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K4 antibody, catalog no. 70R-5785
Degré de pureté :Min. 95%ZNF708 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF708 antibody, catalog no. 70R-8963
Degré de pureté :Min. 95%CD36 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD36 antibody, catalog no. 70R-6098
Degré de pureté :Min. 95%A2BP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of A2BP1 antibody, catalog no. 70R-8489
Degré de pureté :Min. 95%LOC652825 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652825 antibody, catalog no. 70R-2983
Degré de pureté :Min. 95%IL1F10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IL1F10 antibody, catalog no. 70R-10020
Degré de pureté :Min. 95%MPPED2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPPED2 antibody, catalog no. 70R-5251
Degré de pureté :Min. 95%E2F1 antibody
The E2F1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to the E2F1 protein, which is involved in cell cycle regulation and apoptosis. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The E2F1 antibody has been shown to be effective in detecting the activation of tumor necrosis factor-alpha (TNF-α) and beta-catenin signaling pathways. It can also be used to study adipose tissue development and function. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying various cellular processes and signaling pathways.
PDE4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDE4B antibody, catalog no. 70R-2285
Degré de pureté :Min. 95%
