Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of CUEDC1 antibody, catalog no. 70R-1277

A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALNT1 antibody, catalog no. 70R-6346

Mouse monoclonal Influenza A haemagglutinin H1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GMFG antibody, catalog no. 70R-6206

OT-82 is a small-molecule drug that inhibits the HDAC enzyme and has been shown to inhibit cancer growth in vitro and in vivo. It also has anti-inflammatory properties. OT-82 targets myeloid leukemia cells and induces apoptosis through inhibition of histone deacetylases, leading to the activation of proapoptotic proteins, such as Bim and p53. OT-82 is active against pediatric (2 years or younger) chronic lymphocytic leukemia with low expression levels of HDAC1, HDAC2, and HDAC3. In addition, it can be used for the treatment of bone cancer due to its ability to inhibit hdac activity.

ELISA Kit for detection of MMP1 in the research laboratory

The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.

A synthetic peptide for use as a blocking control in assays to test for specificity of TCF25 antibody, catalog no. 20R-1266

A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL4 antibody, catalog no. 70R-7391

CDPPB is a potent, selective, and orally active mGluR5 ligand. It has been shown to inhibit the activation of cell signaling pathways that are involved in dopamine release and glutamate-mediated synaptic transmission. CDPPB is characterized by allosteric activity, which means that it binds to the metabotropic glutamate receptor (mGluR) and alters its function. This drug also inhibits protein synthesis and increases locomotor activity in mice. CDPPB has been studied as a possible treatment for skin cancer and may have therapeutic potential for other diseases of the central nervous system such as Parkinson's disease.

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCG2 antibody, catalog no. 70R-1773

Affinity purified Rabbit polyclonal BBS10 antibody

The ELK1 antibody is a highly specific polyclonal antibody that targets the subtilisin/kexin type of enzymes. It is capable of recognizing and binding to the activated form of ELK1, a transcription factor involved in hepatocyte growth. This monoclonal antibody has been extensively used in various life sciences research applications, particularly in the study of mesenchymal stem cells.

FARS2 antibody was raised in Rabbit using Human FARS2 as the immunogen

ARPC4 antibody was raised in Rabbit using Human ARPC4 as the immunogen

The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.

A synthetic peptide for use as a blocking control in assays to test for specificity of PCCA antibody, catalog no. 70R-2509

A synthetic peptide for use as a blocking control in assays to test for specificity of Gcom1 antibody, catalog no. 70R-3275

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0892 antibody, catalog no. 70R-4236

The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-F antibody, catalog no. 70R-6432

A synthetic peptide for use as a blocking control in assays to test for specificity of CHST13 antibody, catalog no. 70R-7172

A synthetic peptide for use as a blocking control in assays to test for specificity of DRB1 antibody, catalog no. 70R-1352

Affinity purified Rabbit polyclonal HSD17B4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP5 antibody, catalog no. 70R-8021

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM76B antibody, catalog no. 70R-3395

SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK

ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen

RPS9 antibody was raised in rabbit using the C terminal of RPS9 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of VASP antibody, catalog no. 70R-10268

A synthetic peptide for use as a blocking control in assays to test for specificity of ARPP-21 antibody, catalog no. 70R-2326

Zoledronic acid monohydrate EP Impurity B is a chemical impurity often encountered in the synthesis and quality control of zoledronic acid. This impurity arises from synthetic pathways involved in the production of bisphosphonates, a class of compounds used for bone-related conditions. As an impurity, it does not have direct therapeutic action but plays a significant role in the characterization and purity assessment of pharmaceutical formulations.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4826

A synthetic peptide for use as a blocking control in assays to test for specificity of ZADH2 antibody, catalog no. 70R-4445

FERMT3 antibody was raised in Rabbit using Human FERMT3 as the immunogen

Affinity purified Chicken polyclonal Beta Tubulin 3 antibody

The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.

Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.

Rabbit polyclonal RAB3C antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF251 antibody, catalog no. 70R-8227

The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.

A synthetic peptide for use as a blocking control in assays to test for specificity of QPCT antibody, catalog no. 70R-5342

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C3 antibody, catalog no. 70R-2539

Purified Polyclonal MCT8 antibody

Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.

NCLN antibody was raised in Rabbit using Human NCLN as the immunogen

Affinity purified Rabbit polyclonal Claudin 14 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5605

HDAC2 antibody was raised in Rabbit using Human HDAC2 as the immunogen

MEST antibody was raised in Rabbit using Human MEST as the immunogen

Affinity purified Rabbit polyclonal MDH2 antibody

LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Rabbit polyclonal PRKCD antibody

Mouse monoclonal BCAR1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Ctsd antibody, catalog no. 70R-8506

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNS1 antibody, catalog no. 70R-5154

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNMB3 antibody, catalog no. 70R-5170

A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC1 antibody, catalog no. 70R-9538

Affinity purified Rabbit polyclonal CHMP5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of BBS2 antibody, catalog no. 70R-9877

The SAE1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the SAE1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying SAE1 protein levels.

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0999 antibody, catalog no. 70R-9253

Purified recombinant Human NUDT21 protein

ACP6 antibody was raised in Rabbit using Human ACP6 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM166 antibody, catalog no. 70R-6649

A synthetic peptide for use as a blocking control in assays to test for specificity of HSD11B1 antibody, catalog no. 70R-7468

Rabbit polyclonal RAF1 antibody (Ser301)

Prothrombin fragment 1 antibody was raised in sheep using human Prothrombin purified from plasma as the immunogen.

Rabbit polyclonal GPR161 antibody (FITC)

The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of APOH antibody, catalog no. 70R-5421

SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

TFE3 antibody is a highly specific antibody that targets the TFE3 protein, which is involved in regulating gene expression. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It recognizes the antigen with high affinity and specificity, making it an essential tool for researchers in the Life Sciences field.

Affinity purified Rabbit polyclonal TXNDC1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CCNB1 antibody, catalog no. 70R-7825

MICAL2 antibody was raised in Rabbit using Human MICAL2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN17 antibody, catalog no. 70R-6680

A synthetic peptide for use as a blocking control in assays to test for specificity of GJB2 antibody, catalog no. 70R-1685

YIPF4 antibody was raised in rabbit using the N terminal of YIPF4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM59 antibody, catalog no. 70R-6350

DDIT4L antibody was raised in Rabbit using Human DDIT4L as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PARVB antibody, catalog no. 70R-6047

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIPL antibody, catalog no. 70R-9911

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PTGER3 antibody, catalog no. 70R-6481

PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Necap1 antibody, catalog no. 70R-9317

A synthetic peptide for use as a blocking control in assays to test for specificity of RFC3 antibody, catalog no. 70R-5527

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E2 antibody, catalog no. 70R-9622

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD51L3 antibody, catalog no. 70R-10335

ELISA kit for the detection of IGFBP1 in the research laboratory