Produits biochimiques et réactifs

Affinity purified Rabbit polyclonal OSGEP antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6153

ATP5F1 antibody was raised in Rabbit using Human ATP5F1 as the immunogen

WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

A synthetic peptide for use as a blocking control in assays to test for specificity of ZMYND11 antibody, catalog no. 20R-1093

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP5B antibody, catalog no. 70R-1099

Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)

Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.

C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.
High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.

DPP7 antibody was raised in Rabbit using Human DPP7 as the immunogen

The beta Amyloid antibody is a polyclonal antibody used in life sciences research. It specifically targets the beta amyloid protein, which plays a crucial role in the development of Alzheimer's disease. This antibody can be used for various applications such as immunohistochemistry and nuclear staining. By binding to the beta amyloid protein, this antibody helps researchers study its distribution and localization within cells and tissues. Additionally, it can be used as a potential medicament for targeting beta amyloid in therapeutic interventions. The beta Amyloid antibody is highly specific and exhibits strong affinity towards its target, making it an essential tool for studying the pathogenesis of Alzheimer's disease and developing novel treatment strategies.

MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.

The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD2 antibody, catalog no. 70R-8792

Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRQ antibody, catalog no. 70R-5214

The MPO antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to myeloperoxidase (MPO), an enzyme involved in various physiological processes. This antibody has been extensively studied for its role in inflammation, immune response, and cardiovascular diseases.

ELISA kit for detection of RBP4 in the research laboratory

Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of AGXT2L1 antibody, catalog no. 70R-2601

Purified native Human FSH protein (intact)

RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP

The GSTT1 antibody is a highly specific monoclonal antibody that targets the glutathione S-transferase theta 1 (GSTT1) protein. This antibody is commonly used in Life Sciences research to study the role of GSTT1 in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PARP12 antibody, catalog no. 70R-3371

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC13 antibody, catalog no. 70R-4279

A synthetic peptide for use as a blocking control in assays to test for specificity of DRG1 antibody, catalog no. 70R-3104

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF680 antibody, catalog no. 70R-9010

GCK antibody was raised in rabbit using the N terminal of GCK as the immunogen

KCNIP4 antibody was raised in Rabbit using Human KCNIP4 as the immunogen

The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.

CAT antibody was raised in Rabbit using Human CAT as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of HCCS antibody, catalog no. 70R-10236

A synthetic peptide for use as a blocking control in assays to test for specificity of A1BG antibody, catalog no. 70R-8009

The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.

A synthetic peptide for use as a blocking control in assays to test for specificity of Wnt10a antibody, catalog no. 70R-8497

Purified recombinant Human POLR2E protein (His tag)

Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

ELISA kit for the detection of ANA in the research laboratory

Rabbit polyclonal argF antibody (HRP)

Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.

Hamster (CHO) Nidogen-1 ELISA Kit
 
Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.

A synthetic peptide for use as a blocking control in assays to test for specificity of VTN antibody, catalog no. 70R-9584

The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.

The HDAC4 antibody is a highly specific antibody that targets the histone deacetylase 4 (HDAC4) protein. HDAC4 is involved in the regulation of gene expression and plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody can be used for research purposes in the field of Life Sciences to study the function and localization of HDAC4 in different cell types.

Cat IgE ELISA Kit

Rabbit polyclonal UBE2V1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO36 antibody, catalog no. 70R-3784

ASZ1 antibody was raised in Rabbit using Human ASZ1 as the immunogen

The IRS1 antibody is a highly specialized antibody that targets the insulin receptor substrate 1 (IRS1) protein. This protein plays a crucial role in the insulin signaling pathway, which regulates glucose metabolism and energy homeostasis. The IRS1 antibody is designed to specifically recognize and bind to the IRS1 protein, allowing for the detection and quantification of this protein in various biological samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of EPB41 antibody, catalog no. 70R-3846

SPSB2 antibody was raised in rabbit using the N terminal of SPSB2 as the immunogen

Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC33407 antibody, catalog no. 70R-4401

GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PQLC1 antibody, catalog no. 70R-7332

A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC4 antibody, catalog no. 70R-8387

A synthetic peptide for use as a blocking control in assays to test for specificity of ZKSCAN1 antibody, catalog no. 20R-1261

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF451 antibody, catalog no. 70R-8317

ERK2 antibody was raised in Mouse using a purified recombinant fragment of human ERK2 expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA5 antibody, catalog no. 70R-6969

A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6424

A synthetic peptide for use as a blocking control in assays to test for specificity of DPP3 antibody, catalog no. 70R-3626

A synthetic peptide for use as a blocking control in assays to test for specificity of R3HDM2 antibody, catalog no. 70R-4232

Affinity purified Rabbit polyclonal Calpain 5 antibody

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CORIN antibody, catalog no. 70R-1759

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF675 antibody, catalog no. 70R-9564

A synthetic peptide for use as a blocking control in assays to test for specificity of Acd antibody, catalog no. 70R-8190

A synthetic peptide for use as a blocking control in assays to test for specificity of PLCD1 antibody, catalog no. 70R-5852

LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

A synthetic peptide for use as a blocking control in assays to test for specificity of RFPL4B antibody, catalog no. 70R-2776

Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of ALG6 antibody, catalog no. 70R-7343

Affinity purified Rabbit polyclonal beta Tubulin 4 antibody

Purified Polyclonal EAAT3 antibody

Rabbit polyclonal TMEM50B antibody

BIN3 antibody was raised in Rabbit using Human BIN3 as the immunogen

The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.

ELISA Kit for detection of ICAM1 in the research laboratory

The SLC12A5 antibody is a monoclonal antibody that targets the growth factor receptor HER2. It specifically binds to the carbonyl group on HER2, inhibiting its signaling pathway and preventing cell proliferation. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the growth of cancer cells that overexpress HER2. Additionally, the SLC12A5 antibody can be used for immobilization on electrodes to study protein-protein interactions or actin filament dynamics. Its high specificity and affinity make it a valuable tool for researchers studying various biological processes. Furthermore, this antibody has cytotoxic activity against cells expressing the antigen CD33, making it a potential therapeutic option for certain types of cancer.

Rabbit polyclonal UBL4B antibody

Rabbit polyclonal RGAP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DAGLB antibody, catalog no. 70R-7486

A synthetic peptide for use as a blocking control in assays to test for specificity of RPS6KB1 antibody, catalog no. 70R-3692

A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC1 antibody, catalog no. 70R-3979

The SHH antibody is a highly specialized drug antibody used in Life Sciences. It belongs to the class of agonist proteins and is available as both monoclonal and polyclonal antibodies. This antibody is specifically designed to target and bind to the Sonic Hedgehog (SHH) protein, which plays a crucial role in various biological processes such as cell growth and development.

The STAT1 antibody is a specific antibody used in life sciences research. It targets the STAT1 protein, which plays a crucial role in various cellular processes such as immune response and cell growth. This monoclonal antibody can be used to study the activation of p38 MAPK signaling pathway and its effects on mesenchymal stem cells. Additionally, it has been shown to neutralize the effects of hepcidin, a key regulator of iron metabolism. The STAT1 antibody can also be used to investigate the role of interleukin-6 and cannabinoid receptors in different biological systems. Its genotoxic properties make it an essential tool for studying DNA damage and repair mechanisms. With its high specificity and potency, this antibody is widely used by researchers in various fields of life sciences.

ELISA kit for the detection of Fibronectin in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp2r5e antibody, catalog no. 70R-9426