Produits biochimiques et réactifs

LBR antibody was raised in Rabbit using Human LBR as the immunogen

HIV1 p17 antibody was raised in mouse using HIV1 p17 as the immunogen.

Mouse monoclonal GBP2 antibody

Rabbit polyclonal RAB12 antibody

Affinity purified Rabbit polyclonal ZNF165 antibody

CBZ-N-Amido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Rabbit polyclonal TLE3 antibody (N-terminal)

The CD49b antibody is a specific antibody that is commonly used in immunoassays. It is designed to bind to the CD49b protein, which is found on the surface of various cell types including granulosa cells and mesenchymal stem cells. This antibody forms a disulfide bond with the CD49b protein, allowing for easy detection and quantification in biological samples.

AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B1 antibody, catalog no. 70R-1366

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of NR1H2 antibody, catalog no. 70R-1007

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF300 antibody, catalog no. 70R-8106

Ilginatinib maleate is a kinase inhibitor that is used to treat tumor diseases. Ilginatinib maleate inhibits the growth of cancer cells by blocking the epidermal growth factor receptor and epidermal growth factor. It also inhibits the activity of the receptor kinase, which blocks tumor cell growth. Ilginatinib maleate is a human-specific medicine that has been shown to have no effect on healthy cells, making it an attractive treatment for patients with certain types of neoplastic disease.

A synthetic peptide for use as a blocking control in assays to test for specificity of PLD2 antibody, catalog no. 70R-7964

Affinity purified Rabbit polyclonal SHC4 antibody

CBLN2 antibody was raised in Rabbit using Human CBLN2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DGKA antibody, catalog no. 70R-5806

Rabbit polyclonal GPR161 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TINAGL1 antibody, catalog no. 70R-4039

CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.

OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

CADPS antibody was raised in Rabbit using Human CADPS as the immunogen

Rabbit polyclonal IL1RA antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3A1 antibody, catalog no. 70R-4828

TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED

Rabbit polyclonal RNASEH1 antibody

SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD17 antibody, catalog no. 70R-3246

The IBA antibody is a highly effective and versatile product used in the field of Life Sciences. This colloidal, neutralizing antibody has been extensively tested and proven to be effective in various applications. It has shown excellent results in liver microsomes, where it acts as a potent inhibitor of multidrug resistance-associated protein (MRP) and chemokine receptors.

SYTL1 antibody was raised in rabbit using the N terminal of SYTL1 as the immunogen

IFT74 antibody was raised in rabbit using the C terminal of IFT74 as the immunogen

MBP antibody was raised in Rabbit using Human MBP as the immunogen

The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.

TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of IL18 antibody, catalog no. 70R-10163

1-132 amino acids: MSNKFLGTWK LVSSENFDDY MKALGVGLAT RKLGNLAKPT VIISKKGDII TIRTESTFKN EISFKLGQE FEETTADNRK TKSIVTLQRG SLNQVQRWDG KETTIKRKLV NGKMVAECKM KGVVCTRIYE KV

A synthetic peptide for use as a blocking control in assays to test for specificity of FKSG24 antibody, catalog no. 70R-3824

A synthetic peptide for use as a blocking control in assays to test for specificity of RASL10A antibody, catalog no. 70R-5853

A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF4 antibody, catalog no. 70R-4650

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1995

A synthetic peptide for use as a blocking control in assays to test for specificity of GGPS1 antibody, catalog no. 70R-2158

Rabbit polyclonal CEB beta antibody

CDC6 antibody was raised in Rabbit using Human CDC6 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM29A antibody, catalog no. 70R-3438

Rabbit polyclonal RAB3B antibody

The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of WASF3 antibody, catalog no. 70R-2675

SID 26681509 is an enzyme inhibitor that inhibits toll-like receptor (TLR) signaling pathways. TLRs are a family of proteins that act as pattern recognition receptors for the detection of microbial or viral components. SID 26681509 has been shown to inhibit HIV infection in primary cells and to induce autophagy, which may be due to its ability to inhibit methyl transferase activity. It also has been shown to reduce inflammation in mouse models of autoimmune diseases by inhibiting chemoattractant protein expression.

A synthetic peptide for use as a blocking control in assays to test for specificity of TPPP3 antibody, catalog no. 70R-3843

COX5A antibody was raised in Rabbit using Human COX5A as the immunogen

ELISA kit for detection of Rubella in the research laboratory

CDC25A antibody was raised in rabbit using the middle region of CDC25A as the immunogen

Rabbit polyclonal SEC24A antibody

Rabbit polyclonal RPL31 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of bA16L21.2.1 antibody, catalog no. 70R-6333

KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Pyr10 is an advanced catalytic agent, which is derived from modified zeolitic materials with high thermal stability and unique structural properties. Its mode of action involves facilitating pyrolytic reactions by providing active sites that enhance the breakdown of complex organic molecules into simpler compounds. This catalytic activity is primarily due to its porous structure and acid-base active centers, which promote efficient molecular interactions during thermal decomposition.

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS52 antibody, catalog no. 70R-3819

The DNM1 antibody is a highly effective medicament that has shown promising results in inhibiting the growth of carcinoma cell lines. This monoclonal antibody specifically targets a growth factor that is essential for the proliferation of cancer cells, making it a potential breakthrough in cancer treatment. The DNM1 antibody has been extensively studied in Life Sciences and has been proven to be a potent inhibitor of tumor growth. Additionally, this antibody can be used as a selectable marker in research experiments due to its high specificity and sensitivity. With its ability to target specific markers expressed by cancer cells, the DNM1 antibody holds great potential for personalized medicine and targeted therapy approaches.

The APP antibody is a high-quality polyclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and detect amyloid precursor protein (APP), a key player in the formation of amyloid plaques associated with Alzheimer's disease.

Rabbit polyclonal PPIL5 antibody

Purified recombinant Human VBP1 protein (His tag)

UCPH-101 is a peptide that was developed to treat bladder cancer. It is a trimer of the amino acid glutamate, which is an excitatory neurotransmitter in the brain. UCPH-101 has been shown to inhibit the penetration of glutamate into the brain, thereby reducing neuronal damage and excitotoxicity. The uptake of UCPH-101 in the brain was demonstrated using magnetic resonance spectroscopy in vivo. This analog has not yet been tested on humans, but it has been shown to be effective against cancer cells grown in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of UGT2B15 antibody, catalog no. 70R-7532

Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.
Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYNJ1 antibody, catalog no. 70R-4877

CREM antibody was raised in Rabbit using Human CREM as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8643

JND3229 is a synthetic, non-small-cell EGFR inhibitor that targets the kinase domain of EGFR. It has been shown to inhibit the proliferation of mutant EGFR cell lines in vitro and in vivo, as well as tumor growth in xenograft models. JND3229 has also been shown to suppress tumor growth and prolong survival in a mouse model of metastatic cancer. The mechanism of action for this drug is inhibition of the tyrosine kinase activity that is essential for the activation of downstream signaling pathways.

The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.

A synthetic peptide for use as a blocking control in assays to test for specificity of Fa2h antibody, catalog no. 70R-7969

Glucokinase activator, cpd A is a peptide that can be used as a research tool. The protein interacts with the glucokinase receptor and inhibits it, which is a key enzyme in carbohydrate metabolism. Glucokinase activator, cpd A has been shown to inhibit ion channels, and is an inhibitor of the alpha-subunit of the GABA receptor. It also binds to a number of other receptors. This product has high purity and is CAS No. 603108-44-7.

A synthetic peptide for use as a blocking control in assays to test for specificity of PTX3 antibody, catalog no. 70R-5923

ELISA kit for the detection of SSA in the research laboratory

Rabbit polyclonal CUTL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF550 antibody, catalog no. 20R-1242

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3R4 antibody, catalog no. 70R-5627

A synthetic peptide for use as a blocking control in assays to test for specificity of HS1BP3 antibody, catalog no. 70R-4018

A synthetic peptide for use as a blocking control in assays to test for specificity of MLKL antibody, catalog no. 70R-4173

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DDEFL1 antibody, catalog no. 70R-3553

Rabbit polyclonal TGF beta Receptor 2 antibody

Mouse monoclonal FCGR2A antibody

LSM10 antibody was raised in Rabbit using Human LSM10 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL16 antibody, catalog no. 70R-6007

Affinity purified Rabbit polyclonal HLADR beta antibody