Produits biochimiques et réactifs

ELISA Kit for detection of Leptin in the research laboratory

The CCR4 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize neurotrophic factors in the body. It specifically targets and inhibits the activity of TGF-β1, a key factor involved in cholinergic signaling. This antibody binds to specific receptor molecules on cells, preventing the activation of downstream signaling pathways and ultimately leading to a reduction in neurotrophic factor activity.

Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.

PGPC is a chemical compound that has been shown to have antioxidant properties and inhibit skin cancer cells. It has been shown to be effective in a model system for tissue culture, where it inhibited the growth of human monoclonal antibody-producing cells. PGPC has also been shown to have immunosuppressive effects and inhibit the activation of toll-like receptor 4 by bacterial lipopolysaccharides. PGPC has also been shown to have anti-inflammatory effects in autoimmune diseases and cell lysis in myocardial infarcts, atherosclerotic lesions, and other inflammatory diseases.
PGPC may be used as an adjuvant therapy for the treatment of skin cancer, tissue culture, or autoimmune diseases.

USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

CD38 antibody was raised in Mouse using a purified recombinant fragment of human CD38 expressed in E. coli as the immunogen.

Kipukasin H is a new nucleoside antibiotic that is active against both bacteria and fungi. It has been shown to have antibacterial activity against Staphylococcus epidermidis and Aspergillus niger, as well as antifungal activity against Fusarium oxysporum. Kipukasin H is derived from the natural product artemisinin, which has been used for centuries in China to treat malaria. The chemical structure of kipukasin H differs from artemisinin by the addition of a hydroxyl group at C-2′. This modification may be responsible for its increased potency against bacterial cells.

ELISA kit for detection of MMP2 in the research laboratory

Affinity purified Rabbit polyclonal Proteasome 20S alpha 6 antibody

ECSIT antibody was raised in Rabbit using Human ECSIT as the immunogen

MM 11253 is a sophisticated biotechnological research reagent, which is derived from a combination of recombinant DNA technology and protein engineering techniques. Its mode of action involves specific binding to nucleic acid sequences, thus enabling precise manipulation and analysis of genetic material. By leveraging its specific binding properties, MM 11253 can be used to facilitate various genetic studies, including gene expression analysis, DNA sequencing, and genomic mapping.

Rabbit polyclonal GABRA1 antibody

ELISA kit for the detection of PGE2 in the research laboratory

EME1 antibody was raised in Rabbit using Human EME1 as the immunogen

Rabbit polyclonal USP42 antibody

ELISA kit for the detection of Mac2BP in the research laboratory

VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.

TH1834 is a peptide-based inhibitor of protein interactions. It binds to the receptor and prevents the activation of the receptor by its ligand, which blocks signal transduction. TH1834 is used as a research tool for studying ion channels and as an antibody probe for detecting and identifying proteins that bind to receptors.

MYCBPAP antibody was raised in Rabbit using Human MYCBPAP as the immunogen

ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

A synthetic peptide for use as a blocking control in assays to test for specificity of IDE antibody, catalog no. 70R-7840

Affinity purified Rabbit polyclonal SCY1 like 3 antibody

HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Affinity purified Rabbit polyclonal TMLHE antibody

The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.

The MBP antibody is a highly specialized peptide agent that has catalase activity. It acts as an anticoagulant and is commonly used in various research applications in the Life Sciences field. This antibody specifically targets and binds to myelin basic protein (MBP), a key component of the myelin sheath that surrounds nerve fibers. By binding to MBP, this antibody can be used for the detection and quantification of MBP in various biological samples, such as human serum or tissue extracts.

ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Purified Polyclonal ADRB2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EFNB1 antibody, catalog no. 70R-6117

A synthetic peptide for use as a blocking control in assays to test for specificity of CD38 antibody, catalog no. 70R-9672

Mouse monoclonal PIK3AP1 antibody

ELISA kit for the detection of GBM in the research laboratory

Rabbit polyclonal LCN2 antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMCO1 antibody, catalog no. 70R-6893

GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD

Purified recombinant Human CAPS protein

Mouse monoclonal NK1.1 antibody (PE)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF605 antibody, catalog no. 20R-1121

CKS2 antibody was raised in Rabbit using Human CKS2 as the immunogen

MACF1 antibody was raised in Rabbit using Human MACF1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf18 antibody, catalog no. 70R-1161

A synthetic peptide for use as a blocking control in assays to test for specificity of RCHY1 antibody, catalog no. 70R-2245

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing the growth of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

Rabbit polyclonal STARD3NL antibody

The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.

Mouse monoclonal CD40 antibody (PE)

PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

BMVC-8C3O is a fluorescence probe that has been shown to specifically bind to the mitochondria of prostate cancer cells. The uptake of BMVC-8C3O in these cells was observed using confocal laser scanning microscopy and was found to be dependent on the concentration used, with a maximum binding at 1 micromolar. Telomeres are also located within mitochondria and have been shown to have an interaction with BMVC-8C3O. This interaction has been shown to decrease the telomere length, which is linked to cellular senescence and cancer. Cancer cells have also been shown to have an increased amount of BMVC-8C3O, which may be due to their high metabolic rate. The sequence of BMVC-8C3O has not yet been determined, but it is hypothesized that it will interact with dna replication or transcription.

Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.

BNIP1 antibody was raised in Rabbit using Human BNIP1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1C2 antibody, catalog no. 70R-4046

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385D antibody, catalog no. 70R-8969

A synthetic peptide for use as a blocking control in assays to test for specificity of PSG1 antibody, catalog no. 70R-1590

Rabbit polyclonal ZNF238 antibody

NAMPT antibody was raised in Rabbit using Human NAMPT as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of USP15 antibody, catalog no. 70R-9736

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2R1 antibody, catalog no. 70R-8833

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX42 antibody, catalog no. 70R-4789

1-347 amino acids: MGSSHHHHHH SSGLVPRGSH MRVVVIGAGV IGLSTALCIH ERYHSVLQPL DIKVYADRFT PLTTTDVAAG LWQPYLSDPN NPQEADWSQQ TFDYLLSHVH SPNAENLGLF LISGYNLFHE AIPDPSWKDT VLGFRKLTPR ELDMFPDYGY GWFHTSLILE GKNYLQWLTE RLTERGVKFF QRKVESFEEV AREGADVIVN CTGVWAGALQ RDPLLQPGRG QIMKVDAPWM KHFILTHDPE RGIYNSPYII PGTQTVTLGG IFQLGNWSEL NNIQDHNTIW EGCCRLEPTL KNARIIGERT GFRPVRPQIR LEREQLRTGP SNTEVIHNYG HGGYGLTIHW GCALEAAKLF GRILEEKKLS RMPPSHL

Abarelix is a lipoprotein that is used in the treatment of prostate cancer. It modulates protein synthesis by binding to and inhibiting the activity of l-glutamic acid, which is an amino acid that is involved in the production of proteins, including those that are involved in cancer. Abarelix also binds to synthetic polymers, such as polyvinyl alcohol, which may be used for diagnostic purposes. Abarelix has been shown to have anticancer effects with a low toxicity profile in both animal and human trials.

Rabbit polyclonal GPR37 antibody

Rabbit polyclonal POTED antibody

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10210

The STIP1 antibody is a monoclonal antibody that has a stimulatory effect on various biological processes in the Life Sciences field. It specifically targets lectins and autoantibodies, and has been extensively studied for its potential therapeutic applications. This antibody is designed to bind to specific epitopes on the target protein, leading to modulation of various cellular pathways.

Rabbit polyclonal p44 MAPK antibody

DHRS4 antibody was raised in Rabbit using Human DHRS4 as the immunogen

Rabbit polyclonal SMPX antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which ultimately inhibits bacterial growth. Its efficacy has been demonstrated through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDKL5 antibody, catalog no. 70R-9937

SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCD2 antibody, catalog no. 70R-6717

A potent and selective small molecule agonist of GPR119

A synthetic peptide for use as a blocking control in assays to test for specificity of GPI antibody, catalog no. 70R-10234

Donkey anti Goat IgG (H + L) secondary antibody

KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE

A synthetic peptide for use as a blocking control in assays to test for specificity of HFE antibody, catalog no. 70R-5983

Mouse monoclonal anti human CREG1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A4 antibody, catalog no. 70R-6546

A synthetic peptide for use as a blocking control in assays to test for specificity of ATPIF1 antibody, catalog no. 70R-5303

ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen

Rabbit polyclonal OR52A4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Sin3b antibody, catalog no. 70R-8194

The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.