Produits biochimiques et réactifs

AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL

Rabbit polyclonal PGBD3 antibody

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNAB3 antibody, catalog no. 70R-1485

CDC27 antibody was raised in Rabbit using Human CDC27 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC16169 antibody, catalog no. 70R-3259

A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT1 antibody, catalog no. 70R-2469

A synthetic peptide for use as a blocking control in assays to test for specificity of MINK1 antibody, catalog no. 70R-7944

Mouse monoclonal RPN1 antibody

Rat monoclonal Toll-like receptor 9 antibody (biotin)

The TRIM25 antibody is a biomolecule used in Life Sciences for various applications. It is available as both polyclonal and monoclonal antibodies. The TRIM25 antibody has high specificity and affinity for its target, making it an ideal diagnostic reagent.

hybrid peptide (named Bld-1-KLA) composed of the CSNRDARRC peptide (Bld-1), which binds to bladder tumor cells, and the d-KLAKLAKKLAKLAK (KLA peptide) through a GG linker.  This disrupts the mitochondrial membrane and induces apoptotic cell death.

A synthetic peptide for use as a blocking control in assays to test for specificity of MLF2 antibody, catalog no. 70R-6859

KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen

The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.

The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this

CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.

RIPK1-IN-7 is an apoptosis inducer that acts as a histone deacetylase inhibitor. It induces cell death by binding to the mitochondrial membrane, which leads to the release of cytochrome c and other pro-apoptotic factors. RIPK1-IN-7 has been shown to be effective in low doses in vitro, but not in vivo, with necroptosis being a possible mechanism for its lack of activity.

Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)

VER 49009 is a chaperone that binds to the amide group of proteins, inhibiting their function. VER 49009 has been shown to inhibit cancer cells in vitro and in vivo by preventing protein synthesis. This compound also inhibits the production of heat-shock proteins. It can be used for the treatment of cancer, as well as other diseases associated with high levels of heat-shock proteins, such as pediatric cancer.

Mouse monoclonal CD144 antibody (PE)

The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.

Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.

A synthetic peptide for use as a blocking control in assays to test for specificity of Pfkfb2 antibody, catalog no. 70R-9420

Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

LH1307 is a peptide that is an activator of the purinergic receptor P2Y. Purinergic receptors are G protein-coupled receptors that bind to adenosine and ATP, which are nucleotide-based molecules. LH1307 inhibits the binding of adenosine and ATP to their respective receptors, thereby inhibiting the activation of downstream signaling pathways. This inhibition leads to decreased inflammatory responses in cells, as well as increased cell survival rates during periods of stress. LH1307 also binds to a number of other proteins and may be used in research to inhibit these interactions.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A46 antibody, catalog no. 70R-1747

Rabbit polyclonal EDG2 antibody

CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Inhibits mutated EGFR with exon 20 insertion; anti-cancer agent

TIPRL antibody was raised in rabbit using the N terminal of TIPRL as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4G antibody, catalog no. 70R-1918

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC24 antibody, catalog no. 70R-6429

Affinity purified Rabbit polyclonal PSMC6 antibody

Crotamine is a bioactive compound that is isolated from Croton tiglium, which is a plant indigenous to Southeast Asia. It is the most active component of the extract, and has been shown to have anti-inflammatory properties in various animal models. Crotamine has been used as an analytical standard for HPLC and can be used as a reference material for screening purposes. CAS No. 58740-15-1

Collagen Type VI Alpha 2 antibody was raised using the C terminal of COL6A2 corresponding to a region with amino acids ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI

The BCL2L1 antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP), a biomarker associated with various diseases including cancer. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in detecting and quantifying AFP levels in human serum samples. The BCL2L1 antibody binds to AFP with high affinity, making it an ideal tool for diagnostic purposes. Additionally, this antibody has also been used in research studies to investigate the role of AFP in cholinergic signaling, epidermal growth factor (EGF) signaling, and β-catenin activation. Its versatility and specificity make the BCL2L1 antibody a valuable tool for scientists and researchers working in diverse fields such as oncology, immunology, and molecular biology.

Rabbit polyclonal CKX2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL3 antibody, catalog no. 70R-2129

PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 20µg vial.

ELISA Kit for detection of NGFb in the research laboratory

Quinotolast sodium is a research tool that has been shown to activate the receptor for substance P. It is also a ligand that binds to the receptor for substance P and blocks the ion channels of the cells, thereby inhibiting pain. Quinotolast sodium has been used in research studies involving antibody-antigen reactions, protein interactions, and pharmacology. It is an inhibitor of peptides and can be used as a reagent for chromatography. Quinotolast sodium is not yet approved for human use.

A protein trafficking modulator; affects endocytic trafficking to the vacuole in plant and yeast cells

LY 233053 is a polylactic acid-based drug that is used in the treatment of inflammatory pain. It has been shown to have a high affinity for glutamate receptors, which may be due to its carbonyl group. LY 233053 also has an anti-cancer effect, as it inhibits the growth of cancer cells by stimulating neuronal death. LY 233053 is not absorbed orally and must be given intravenously or intramuscularly. This drug is also used in diagnostic agents for research on glutamate and the brain.

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRA1 antibody, catalog no. 70R-5213

Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

K-Ras(G12C) inhibitor 12 is a histone deacetylase inhibitor that has been shown to sensitize mutant K-Ras-expressing cells to chemotherapeutic drugs. It also has the potential to be used as a diagnostic tool for colon cancer. This compound has been shown to enhance the anti-tumour activity of other cancer medicines, such as 5-fluorocytosine and oxaliplatin, in pancreatic cancer cells.

ELISA kit for the detection of Gliadin IgA in the research laboratory

Armenian Hamster monoclonal CD29 antibody (PE)

Rabbit polyclonal TRMT5 antibody

Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.

sRANKL antibody (biotin) was raised in goat using highly pure recombinant human sRANKL as the immunogen.

Rabbit polyclonal Bcl-xL antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EDIL3 antibody, catalog no. 70R-9143

ZIM3 antibody was raised in rabbit using the middle region of ZIM3 as the immunogen

Peptide H-TGLQEVEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Roflupram is a selective inhibitor of the enzyme response element binding protein (RBP), which is responsible for the activation of gene expression in the nucleus. It has been shown to inhibit the production of inflammatory mediators such as TNF-α, IL-1β, and IL-6. Roflupram also inhibits the production of amyloid protein by microglia cells, which may be related to its clinical relevance in treating Alzheimer's disease. Roflupram binds to RBP with high affinity and specificity, blocking its interaction with DNA and preventing gene expression. This drug may be used to treat autoimmune diseases or even cancer due to its ability to inhibit tumor growth.

MCP4 antibody was raised in mouse using highly pure recombinant human MCP-4 as the immunogen.

EHF antibody was raised in Rabbit using Human EHF as the immunogen

Rabbit polyclonal SYT1 antibody (Ser309)

LDN 214117 is a small molecule that has been shown to inhibit the activity of a variety of receptors including G protein-coupled receptors, tyrosine kinase receptors, and chemokine receptors. LDN 214117 binds to the ligand binding site of these receptors and blocks signal transduction. LDN 214117 is not active against mesenchymal stem cells or epidermal growth factor receptor (EGFR) expressing cancer cells, which may be due to its low expression in these cells. This drug has also been shown to have pharmacokinetic properties that allow for oral administration.

Mouse monoclonal JEV PreM antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARL3 antibody, catalog no. 70R-9841

The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.

IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.

DBP antibody was raised in mouse using recombinant Albumin D-Box Binding Protein

MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.

Mescaline  Conjugate for use in immunoassays

Affinity purified Rabbit polyclonal RGS14 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FBP2 antibody, catalog no. 70R-3380

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

Please enquire for more information about 4-[3-(4-Morpholinyl)propoxy]-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page

BXDC1 antibody was raised in Rabbit using Human BXDC1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZGPAT antibody, catalog no. 70R-4430

Rabbit polyclonal STAT1 antibody (Ser727)

N-Nitrosodesipramine is an analog of the antidepressant drug desipramine that has been shown to have anticancer properties. It inhibits the activity of kinases, which are proteins that play a key role in cancer cell growth and division. N-Nitrosodesipramine has been found to induce apoptosis, or programmed cell death, in human and Chinese hamster cancer cells. This compound is also a potent inhibitor of tolvaptan, a drug used to treat hyponatremia (low sodium levels) in patients with heart failure or liver disease. N-Nitrosodesipramine is excreted in urine and may be useful as a biomarker for exposure to nitrosamines, which are known carcinogens.

A synthetic peptide for use as a blocking control in assays to test for specificity of H1FOO antibody, catalog no. 70R-2025

A synthetic peptide for use as a blocking control in assays to test for specificity of LUC7L antibody, catalog no. 70R-9549

IDH2 antibody was raised in Rabbit using Human IDH2 as the immunogen

Rabbit polyclonal RNF181 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of WDSOF1 antibody, catalog no. 70R-4238

Mouse monoclonal DNAJA2 antibody

Affinity purified Rabbit polyclonal LALBA antibody

JUNB antibody was raised in Rabbit using Human JUNB as the immunogen

Canine Serum is a high-quality biospecimen that is commonly used in veterinary applications. It is derived from the blood of canines and contains a variety of important components such as antibodies, cytokines, and enzymes. Canine Serum has a moderate viscosity, which allows for easy handling and processing in laboratory settings.

The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for

A synthetic peptide for use as a blocking control in assays to test for specificity of SMARCD1 antibody, catalog no. 70R-3053

Rabbit polyclonal POLR3K antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4F3 antibody, catalog no. 70R-7504

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC37B antibody, catalog no. 70R-6920

A synthetic peptide for use as a blocking control in assays to test for specificity of PKM2 antibody, catalog no. 70R-9542

A synthetic peptide for use as a blocking control in assays to test for specificity of PWWP2A antibody, catalog no. 70R-2966

Gr 55562 dihydrochloride is a chemical compound that interacts with dopamine, serotonin, and norepinephrine receptors. It has been shown to have potent anti-inflammatory properties in animal models of chronic pain. In addition, Gr 55562 dihydrochloride has been shown to be effective in controlling hyperactivity and neuropathic pain in animals. This drug also enhances the effects of other drugs that are used to treat psychostimulant addiction, such as cocaine or amphetamine.

The RED antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is designed to neutralize the activity of EPO by inhibiting its endocytic uptake. This antibody has been extensively used in immunoassays to detect and quantify EPO levels in various biological samples. The RED antibody is highly specific and exhibits minimal cross-reactivity with other proteins or molecules. It is produced using state-of-the-art technology and undergoes rigorous quality control to ensure its effectiveness and reliability. In addition, the RED antibody is formulated with excipients that enhance its stability and shelf life. Whether you are conducting research in Life Sciences or developing therapeutic agents, the RED antibody can be a valuable tool for studying EPO-related processes, such as erythropoiesis or the interaction of EPO with human endothelial cells. Its use can also help elucidate the role of EPO in various physiological and pathological conditions. With its high affinity and neutralizing properties, the RED