Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIML2 antibody, catalog no. 70R-4257

Blocker of P/Q-type calcium channel (Cav2.1)

A synthetic peptide for use as a blocking control in assays to test for specificity of LRCH4 antibody, catalog no. 70R-7119

Azido-dPEG®7-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®7-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM115 antibody, catalog no. 70R-7397

Antagonist of hedgehog signaling pathway activator Smoothened; antineoplastic

4-Formyl-Benzamido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

UMOD antibody was raised in rabbit using the C terminal of UMOD as the immunogen

Rilmazafone is a peptide that belongs to the class of activators. It has been shown to stimulate antibody production in research animals and may be used as a research tool for studying the function of ion channels and protein interactions. Rilmazafone has also been found to inhibit the activity of receptors, ligands, and ion channels.

Rabbit polyclonal Beta Enolase antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-7149

A synthetic peptide for use as a blocking control in assays to test for specificity of PTBP1 antibody, catalog no. 70R-4626

Affinity purified Rabbit polyclonal NDUFS2 antibody

Primary SIL peptide for Emicizumab  detection and quantification

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB6 antibody, catalog no. 70R-10057

The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.

Affinity purified Rabbit polyclonal KIAA0494 antibody

CD8a antibody (biotin) was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.

Thiol-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

MGAT2-IN-1 is a peptide research tool that activates the MGAT2 receptor. It has been shown to inhibit the binding of L-Lysine to the MGAT2 receptor with an IC50 value of 2.5 µM. This peptide also inhibits the binding of GABA to the GABA A receptor with an IC50 value of 3 µM. MGAT2-IN-1 has been shown to bind to a number of different receptors, including muscarinic acetylcholine receptors and nicotinic acetylcholine receptors, as well as opioid receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of FNTA antibody, catalog no. 70R-1202

SARS-CoV-2 Spike RBM 450-473 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Motif (RBM). SARS-CoV-2 Spike RBM 450-473 peptide is useful for vaccine development and for structure-activity relationship studies
SARS-CoV-2 Spike (S) glycoprotein
Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.
With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.
SARS-CoV-2 Spike RBM:
The receptor-binding domain in SARS-CoV-2 Spike protein contains a receptor-binding motif RBM. SARS-CoV-2 Spike RBM is the main functional motif in RBD and allows contacts between the S protein and the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.
SB-PEPTIDE also offers SARS-CoV-2 Spike RBM 450-473 (Biotin-LC) peptide

Rabbit polyclonal SDF2L1 antibody

Rabbit polyclonal TMSB4X antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF681 antibody, catalog no. 70R-9108

A synthetic peptide for use as a blocking control in assays to test for specificity of CNN2 antibody, catalog no. 70R-2274

CAMK2B antibody was raised in Rabbit using Human CAMK2B as the immunogen

IFT52 antibody was raised in Rabbit using Human IFT52 as the immunogen

Cathelicidin antimicrobial peptide, human, recombinant is a recombinant peptide that has been artificially synthesized. This peptide functions as an antimicrobial to inhibit the growth of bacteria by binding to cellular membranes and disrupting their integrity. Cathelicidin antimicrobial peptide, human, recombinant is expressed in extracellular fluids and functions as chemotaxis and n-terminal signal peptides. The molecular mass of cathelicidin antimicrobial peptide, human, recombinant is 17 kDa. It is active against Escherichia coli, but not against other organisms such as yeast or protozoa. Cathelicidin antimicrobial peptide, human, recombinant also has an inflammatory response in the body (e.g., fever).

Rabbit polyclonal GABRA6 antibody

DLAT antibody was raised in Rabbit using Human DLAT as the immunogen

DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Biotin-SARS-CoV-2 Spike RBM 480-496 (Biotin-LC) peptide is the biotinylated version of SARS-CoV-2 Spike RBM 480-496 peptide. SARS-CoV-2 Spike RBM 480-496 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Motif (RBM). Biotin-SARS-CoV-2 Spike RBM 480-496 peptide is useful for vaccine development and for structure-activity relationship studies
SARS-CoV-2 Spike (S) glycoprotein
Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.
With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.
SARS-CoV-2 Spike RBM:
The receptor-binding domain in SARS-CoV-2 Spike protein contains a receptor-binding motif RBM. SARS-CoV-2 Spike RBM is the main functional motif in RBD and allows contacts between the S protein and the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDH4 antibody, catalog no. 70R-6191

A synthetic peptide for use as a blocking control in assays to test for specificity of GRM6 antibody, catalog no. 70R-7940

A synthetic peptide for use as a blocking control in assays to test for specificity of Cpne5 antibody, catalog no. 70R-9505

m-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Region of SDF1 protein corresponding to amino acids KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKSNNRQVC IDPKLKWIQE YLDKALNK.

Bis-dPEG®13-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®13-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

A synthetic peptide for use as a blocking control in assays to test for specificity of HISPPD1 antibody, catalog no. 70R-2403

α7 nicotinic acetylcholine receptor (nAChR) antagonist

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of SOX7 antibody, catalog no. 70R-8385

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

Amino-dPEG®12-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, amino-dPEG®12-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

BNIPL antibody was raised in Rabbit using Human BNIPL as the immunogen

Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.

Bis-dPEG®9-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®9-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

A synthetic peptide for use as a blocking control in assays to test for specificity of DCXR antibody, catalog no. 70R-3264

A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP1 antibody, catalog no. 70R-10403

Rabbit polyclonal CPLA2 antibody (Ser505)

A synthetic peptide for use as a blocking control in assays to test for specificity of FAF1 antibody, catalog no. 70R-10344

GSTM4 antibody was raised in Rabbit using Human GSTM4 as the immunogen

Rabbit polyclonal PRPF4 antibody

The ITGB3 antibody is a highly specialized polyclonal antibody that acts as a family kinase inhibitor. It is designed to target and neutralize specific factors in the body, making it an effective antiviral and factor antagonist. This antibody also serves as a cdk4/6 inhibitor, inhibiting the activity of cyclin-dependent kinases 4 and 6.

Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

C24 Ceramide (d18:1/24:0) is a sphingolipid molecule, which is a fundamental component of cell membranes. This specific ceramide is derived from the lipid class known for its critical role in maintaining the integrity and functionality of the stratum corneum. The structure comprises a long-chain sphingoid base, d18:1, linked to a saturated 24-carbon fatty acid, 24:0, facilitating its incorporation into the lipid bilayer.

Dofequidar fumarate is an anticancer drug that belongs to the class of pyrimidine compounds. It has been shown to inhibit growth of cancer cells in clinical studies. Dofequidar fumarate inhibits the production of epidermal growth factor, which may be due to its ability to inhibit the activity of p-glycoprotein (P-gp). Dofequidar fumarate also has a high affinity for cancer tissue and can be used as a chemosensitizer, increasing the effectiveness of other anticancer drugs such as degarelix acetate.

H-Arg-Arg-Arg-Arg-OH is a peptide that belongs to the group of activators. It has been shown to activate the immune system by stimulating antibody production, and is used as a research tool for studying ion channels, life science, cell biology, and pharmacology. H-Arg-Arg-Arg-Arg-OH has been shown to act as an inhibitor of protein interactions in various systems. The receptor for this peptide is unknown.

IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.

Portion of EBV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of BUB3 antibody, catalog no. 70R-5623

A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_20426 antibody, catalog no. 70R-8776

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFSD antibody, catalog no. 70R-4964

A synthetic peptide for use as a blocking control in assays to test for specificity of APOA4 antibody, catalog no. 70R-5429

Heat shock protein 90 (HSP90) inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of DHRS9 antibody, catalog no. 70R-5476

Please enquire for more information about KYT-36 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Rabbit polyclonal PP1C gamma antibody

CDYL antibody was raised in Rabbit using Human CDYL as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SETD2 antibody, catalog no. 20R-1264

(2S)-Arimoclomol maleate is a ligand that is used in research as a cell biology tool. It is an inhibitor of potassium channels, which are ion channels that activate the release of neurotransmitters. It has been shown to be a high-quality reagent and is used to study protein interactions, receptor activation, and pharmacology. Additionally, this compound can be used as a research tool in the field of cell biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC50722 antibody, catalog no. 70R-4281

A synthetic peptide for use as a blocking control in assays to test for specificity of TBL3 antibody, catalog no. 70R-5869

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS10 antibody, catalog no. 70R-1420

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC8 antibody, catalog no. 70R-6686

ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Inhibits chaperone protein Hsp90; antineoplastic

The Caspase 1 antibody is a highly effective tool for immunoassays and research purposes. This antibody specifically targets caspase 1, a key enzyme involved in inflammatory responses and cell death. It has been shown to neutralize the activity of caspase 1, making it an essential component for studies related to fibronectin, insulin, collagen, β-catenin, and other growth factors.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC2 antibody, catalog no. 70R-7035

A synthetic peptide for use as a blocking control in assays to test for specificity of CALB2 antibody, catalog no. 70R-2905

The YTHDF1 antibody is a highly specialized monoclonal antibody that targets the YTH domain family protein 1 (YTHDF1). This peptide system plays a crucial role in various biological processes, including RNA metabolism and translation regulation. The YTHDF1 antibody is designed to specifically bind to YTHDF1 and neutralize its activity.

Armenian Hamster monoclonal CD80 antibody (FITC)

Rat monoclonal OCT3/4 antibody (PE)

Rabbit polyclonal PLS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TPX2 antibody, catalog no. 70R-5626

ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP

A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G2 antibody, catalog no. 70R-3658

Mouse monoclonal KIAA0495 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2O antibody, catalog no. 70R-3984

A synthetic peptide for use as a blocking control in assays to test for specificity of ROPN1L antibody, catalog no. 70R-10111