Produits biochimiques et réactifs

Catalogue peptide; min. 95% purity

Trifluoroacetate salt

Boc-Phe-Gly-Gly-OH is a peptide that can be used in the synthesis of peptides. It has reactive moieties and is a carboxylic acid with an aromatic amino group. Boc-Phe-Gly-Gly-OH is a site-specific catalyst that reacts with hydroxyl groups on the ligation side to form amide bonds. The catalytic mechanism of this compound involves a nucleophilic attack by the carbonyl oxygen atom on the electrophilic carbon atom, forming an intermediate iminium ion. This intermediate then tautomerizes to give the desired product and CO2.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.

Catalogue peptide; min. 95% purity

Hydroxybupropion is a drug that is used to treat depressive disorders. It acts as a nicotinic acetylcholine receptor antagonist and a dopamine uptake inhibitor, which increases the levels of dopamine in the brain. It is also an antidepressant with clinical response after oral administration. The plasma concentration-time curve of hydroxybupropion can be found by using both the conventional single-phase linear regression method and a nonlinear mixed effects model. This drug may interact with other drugs, such as antidepressants and antipsychotics, and has been shown to increase their levels in the blood stream. Hydroxybupropion also interacts with drugs that affect metabolism, such as α1-acid glycoprotein, or are taken up by the liver, such as acetylcholinesterase inhibitors. The chemical stability of hydroxybupropion can be determined by examining its stereoselectivity for acetylcholine receptors, which is dependent on pH.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Methyl-d3-magnesium iodide solution, 1.0 M in diethyl ether, is a specialized organometallic reagent used extensively in synthetic chemistry. This compound is a labeled Grignard reagent, where the methyl group is fully deuterated. It is sourced through the synthesis involving the reaction of deuterated methyl iodide with magnesium in an anhydrous diethyl ether solvent.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

DDD85646 is a potent inhibitor of leishmania. It binds to the active site of protein synthesis by blocking the aminoacyl-tRNA binding site. DDD85646 has been shown to have a significant interaction with chemotherapeutic drugs, including doxorubicin and vincristine. This molecule may be a potential drug target for the treatment of cancer and infectious diseases. DDD85646 also inhibits fatty acid synthesis, which may lead to weight loss.

Catalogue peptide; min. 95% purity

Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.

Catalogue peptide; min. 95% purity

Lanabecestat is an investigational drug, classified as a beta-secretase (BACE) inhibitor, which is derived from synthetic chemical processes. Its mode of action involves inhibiting the enzyme beta-secretase, which plays a crucial role in the amyloidogenic pathway by cleaving amyloid precursor protein (APP) into amyloid-beta peptides. The accumulation of these peptides is a hallmark of Alzheimer's disease pathology.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

HMG-CoA reductase antagonist

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.

Disulfide bond is a covalent chemical bond that links two sulfur atoms to each other. Disulfides are the major form of sulfur-containing proteins, and are important in many biological processes, such as postnatal development, biliary function, hepatitis diagnosis and cancer. Disulfide bonds can be detected using chromatographic methods such as high performance liquid chromatography (HPLC) or gas chromatography (GC). The biosynthesis of disulfides is an essential process in the metabolism of glutathione. Disulfide bonds are formed by the oxidation of two sulfhydryl groups (-SH) in a protein by reactive oxygen species (ROS), which results in the formation of a single disulfide bond between two cysteine residues. This reaction requires glutathione as a cofactor, which catalyzes the formation of -S-S- bridges between two cysteine residues by reducing them to their corresponding thiols (-SH). Glutathione also

Catalogue peptide; min. 95% purity

Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial

Catalogue peptide; min. 95% purity

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Cyclopyrimorate is a small molecule that has been shown to inhibit the activity of protein kinase C (PKC). Cyclopyrimorate is a potent activator of PKC, and it has been shown to interact with both the ligand binding domain and the activation domain. This inhibitor binds to the ATP binding site on PKC, blocking access by ATP and inhibiting phosphorylation. Cyclopyrimorate has also been shown to have effects on ion channels, including voltage-gated potassium channels, calcium activated potassium channels, and nicotinic acetylcholine receptors. Cyclopyrimorate is a research tool for studying protein interactions in cells. It can be used as an antibody against PKC for immunocytochemistry or Western blotting experiments.

Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

2-Epi-darunavir is a peptide that acts as an activator of the HIV-1 protease. It has been shown to be a potent inhibitor of HIV-1 protease, with IC50 values in the low nanomolar range. The 2-Epi-darunavir peptide binds to the active site of HIV-1 protease, blocking access by other molecules and preventing cleavage at the P1' position on the substrate. This results in a conformational change that prevents its interaction with the binding site on HIV-1 gp41. The 2-Epi darunavir peptide also inhibits protein interactions with ion channels and receptor proteins, which may inhibit cellular processes such as cell proliferation and apoptosis.

Semaglutide impurity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about ent-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Hypoglycemic agent

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

SMN-C3 is a synthetic compound designed specifically as a targeted therapeutic agent. It is derived through advanced chemical synthesis techniques, utilizing a meticulous approach to optimize efficacy and specificity. The mode of action of SMN-C3 involves precise interaction with select molecular targets, thereby modulating biological pathways with high specificity. This interaction is designed to alter the course of disease processes, offering potential therapeutic benefits.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CAS No. 117592-45-7 is an ion channel activator that belongs to the group of peptides. It is a high purity product with a purity of 99.5% and has been purified by HPLC. CAS No. 117592-45-7 activates voltage-gated sodium channels in neuronal tissue, which may be due to its ability to bind to the receptor site and activate it, or by binding to the protein and changing its conformation to allow ions through the channel pore. The specificity of this ligand has been shown using antibody inhibition assays on rat erythrocytes and human erythrocytes.

Catalogue peptide; min. 95% purity

Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.

Catalogue peptide; min. 95% purity

Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity