Produits biochimiques et réactifs

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

(S)-Luliconazole is an antifungal agent that is synthesized from an imidazole compound. This compound is biphenyl in structure and is often derived through chiral synthesis techniques to isolate the (S)-enantiomer, which is the active form that enhances pharmacological effects. Its mode of action involves inhibiting the enzyme lanosterol 14α-demethylase, an essential component in fungal cell membrane synthesis. This inhibition disrupts the production of ergosterol, a critical sterol in fungal membranes, ultimately leading to increased membrane permeability and cell death.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Calmodulin-dependent protein kinase II (CAMKII) is a calcium/calmodulin-dependent enzyme that plays an important role in the regulation of cardiac contractility. CAMKII is activated by the binding of beta-adrenergic and other hormones to their receptors on the plasma membrane, leading to a change in the membrane potential. CAMKII then phosphorylates myofibrils, which leads to an increase in cardiac contractility. In liver cells, CAMKII activation leads to an increase in contractility and perfusion through increased ethylene production.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Potent P-glycoprotein (P-gp) inhibitor

Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.

Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Semaglutide impurity

S-sulfo-L-cysteine sodium is a high purity antibody that can be used as a research tool. It has been shown to interact with ion channels and protein interactions. S-sulfo-L-cysteine sodium is also used in the study of cell biology, pharmacology, and receptor binding. This substance is a ligand that activates or inhibits certain receptors, specifically peptides and ion channels. The CAS number for this molecule is 7381-67-1.

CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.

Catalogue peptide; min. 95% purity

SMN-C3 is a synthetic compound designed specifically as a targeted therapeutic agent. It is derived through advanced chemical synthesis techniques, utilizing a meticulous approach to optimize efficacy and specificity. The mode of action of SMN-C3 involves precise interaction with select molecular targets, thereby modulating biological pathways with high specificity. This interaction is designed to alter the course of disease processes, offering potential therapeutic benefits.

Catalogue peptide; min. 95% purity

Boc-Phe-Gly-Gly-OH is a peptide that can be used in the synthesis of peptides. It has reactive moieties and is a carboxylic acid with an aromatic amino group. Boc-Phe-Gly-Gly-OH is a site-specific catalyst that reacts with hydroxyl groups on the ligation side to form amide bonds. The catalytic mechanism of this compound involves a nucleophilic attack by the carbonyl oxygen atom on the electrophilic carbon atom, forming an intermediate iminium ion. This intermediate then tautomerizes to give the desired product and CO2.

Full agonist of the μ-opioid receptor (MOR) with Ki of 383 nM. It also weakly agonizes the δ-opioid receptor (DOR) with a Ki >10 μM. Tianeptine has antidepressant effects but can also regulate neuroplasticity in the amygdala and stress-induced release of glutamate. It can generate analgesia and reward, typical opiate-like behavioural effects, but does not induce tolerance or withdrawal.

Catalogue peptide; min. 95% purity

EC 23 is a synthetic retinoid that belongs to the class of chemical compounds called retinoids. Retinoids are natural or synthetic substances that have a high affinity for binding to receptors on the cell surface and activating them. EC 23 has been shown to induce bacterial enzymes that break down long-chain fatty acids, which are toxic to bacteria. It also has been shown to be potent inducers of cellular differentiation in certain animal models, including the mouse embryo eye. EC 23 binds with high affinity to bacterial enzyme and inhibits its activity. It also has been shown to inhibit the growth of certain types of cancer cells in culture, but not others.

Catalogue peptide; min. 95% purity

AZD5069 is a small molecule that serves as a potent and selective antagonist of the CXC chemokine receptor 2 (CXCR2). It is derived from synthetic pharmaceutical research efforts aimed at targeting key signaling pathways in inflammatory diseases. This compound functions by inhibiting the CXCR2 receptor, which plays a critical role in the recruitment and activation of neutrophils, a type of white blood cell involved in inflammation and immune responses.

Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.

Catalogue peptide; min. 95% purity

nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent

Catalogue peptide; min. 95% purity

Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.

Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

DDD85646 is a potent inhibitor of leishmania. It binds to the active site of protein synthesis by blocking the aminoacyl-tRNA binding site. DDD85646 has been shown to have a significant interaction with chemotherapeutic drugs, including doxorubicin and vincristine. This molecule may be a potential drug target for the treatment of cancer and infectious diseases. DDD85646 also inhibits fatty acid synthesis, which may lead to weight loss.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Calcipotriol is a synthetic vitamin D3 analog that has been shown to be effective in the treatment of bone cancer. It has a film-forming property and is used in pharmaceutical preparations as well as for wastewater treatment. Calcipotriol monohydrate is made by reacting calcipotriol with hydrochloric acid, which produces an ester bond between the hydroxyl group and the carboxylic acid group. The reaction also produces water, methanol, and methyl ethyl ether. Studies have shown that calcipotriol monohydrate has a chemical stability of over 30 days at room temperature, indicating it can be stored for long periods without degradation.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity