Produits biochimiques et réactifs

Hypoglycemic agent

Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page

Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.

Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Cyclopyrimorate is a small molecule that has been shown to inhibit the activity of protein kinase C (PKC). Cyclopyrimorate is a potent activator of PKC, and it has been shown to interact with both the ligand binding domain and the activation domain. This inhibitor binds to the ATP binding site on PKC, blocking access by ATP and inhibiting phosphorylation. Cyclopyrimorate has also been shown to have effects on ion channels, including voltage-gated potassium channels, calcium activated potassium channels, and nicotinic acetylcholine receptors. Cyclopyrimorate is a research tool for studying protein interactions in cells. It can be used as an antibody against PKC for immunocytochemistry or Western blotting experiments.

Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.

HMG-CoA reductase antagonist

FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial

Please enquire for more information about Amyloid beta-Protein (1-42) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Calmodulin-dependent protein kinase II (CAMKII) is a calcium/calmodulin-dependent enzyme that plays an important role in the regulation of cardiac contractility. CAMKII is activated by the binding of beta-adrenergic and other hormones to their receptors on the plasma membrane, leading to a change in the membrane potential. CAMKII then phosphorylates myofibrils, which leads to an increase in cardiac contractility. In liver cells, CAMKII activation leads to an increase in contractility and perfusion through increased ethylene production.

Catalogue peptide; min. 95% purity

Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Please enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page

AZD5069 is a small molecule that serves as a potent and selective antagonist of the CXC chemokine receptor 2 (CXCR2). It is derived from synthetic pharmaceutical research efforts aimed at targeting key signaling pathways in inflammatory diseases. This compound functions by inhibiting the CXCR2 receptor, which plays a critical role in the recruitment and activation of neutrophils, a type of white blood cell involved in inflammation and immune responses.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

L-alpha-Phosphatidylserine sodium salt, derived from porcine brain, is a research chemical that has shown promising potential in various fields. It has been studied for its role in HIV-1 infection, where it has been found to inhibit the fusion of the virus with host cells. Additionally, L-alpha-Phosphatidylserine sodium salt has shown positive effects on spermatozoa motility and fertility. In cancer research, L-alpha-Phosphatidylserine sodium salt has been investigated for its ability to enhance the efficacy of certain anti-cancer drugs. It is believed to work by increasing the uptake of these drugs into cancer cells, thereby improving their effectiveness. This compound also plays a role in neurological health. It is involved in the synthesis of steroidal hormones and neurotransmitters such as dopamine. Studies have suggested that L-alpha-Phosphatidylserine sodium salt may support cognitive function and memory. Furthermore, L-alpha-Ph

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.

Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page

Catalogue peptide; min. 95% purity

Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.

The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes

Fluorescent derivative of cyclopamine

8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.

Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.

Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.

FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.

Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.

Fentanyl p Conjugate for use in immunoassays

1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.

Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.

a brain-penetrating activator of eukaryotic initiation factor 2B (eIF2B) that inhibits the abnormal integrated stress response

Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page

L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.

S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing

CB-1158 is an arginase inhibitor, which is a small molecule derived from a synthetic source designed to modulate immune functions. Its mode of action involves the inhibition of the arginase enzyme, a key player in the urea cycle responsible for the hydrolysis of arginine into ornithine and urea. By blocking arginase, CB-1158 effectively prevents the depletion of extracellular arginine, a vital amino acid required for the activation and proliferation of T cells within the immune system. This inhibition leads to enhanced immune responses against tumors.

Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab

L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.

Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.
There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.
Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.
Parainfluenza Virus Type 2 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-2 infection. It can also be used as a research tool in vaccine development.