Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.014 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.371 produits)
130589 produits trouvés pour "Produits biochimiques et réactifs"
TNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formule :C51H91N19O18Masse moléculaire :1,258.41 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molBax-BH3L63A
Catalogue peptide; min. 95% purity
Formule :C74H129N22O27SMasse moléculaire :1,791.05 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formule :C42H66N10O15Masse moléculaire :951.05 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formule :C149H224N44O45SMasse moléculaire :3,383.78 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formule :C75H114N24O19Masse moléculaire :1,655.89 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formule :C33H47N9O8SMasse moléculaire :729.86 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formule :C176H251N43O53SMasse moléculaire :3,849.30 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molδ-Endorphin
Catalogue peptide; min. 95% purity
Formule :C83H131N19O27SMasse moléculaire :1,859.14 g/molPF 05175157
CAS :PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.
Formule :C23H27N5O2Degré de pureté :Min. 95%Masse moléculaire :405.49 g/mol[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formule :C175H272N54O59S6Masse moléculaire :4,268.78 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formule :C40H52N10O13Masse moléculaire :880.92 g/molSalmefamol
CAS :A β2-adrenoceptor agonist that is structurally related to salbutamol. Ellicits β-adrenergic stimulatory effects on smooth muscles in trachea and bronchi. More effective (1.5 to 2 times more) as a bronchodilator than salbutamol.
Formule :C19H25NO4Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :331.41 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formule :C23H28N4O4Masse moléculaire :424.50 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
γ-TAC4 (32-50)
Catalogue peptide; min. 95% purity
Formule :C92H146N24O31Masse moléculaire :2,084.33 g/molHypoxanthine-13C2,15N
CAS :Hypoxanthine-13C2,15N is an inhibitor that has been used in Chinese medicine to treat a variety of ailments. It is an analog of hypoxanthine, a naturally occurring substance found in urine. Hypoxanthine-13C2,15N has been shown to inhibit the production of calcitonin, a hormone produced by the thyroid gland that regulates calcium levels in the blood. It also inhibits the activity of kinases, enzymes that play a role in cell division and growth. Studies have shown that hypoxanthine-13C2,15N can induce apoptosis (programmed cell death) in cancer cells, making it a potential treatment for various types of tumors. Additionally, this substance has been found to inhibit the activity of oxytocin and galanin, two neuropeptides involved in various physiological processes. Overall, hypoxanthine-13C2,15N shows promising potential as a therapeutic agent for cancer and other diseases
Formule :C5H4N4ODegré de pureté :90%Masse moléculaire :139.09 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formule :C35H56N8O9SMasse moléculaire :765 g/molα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formule :C52H74N20O15S4Masse moléculaire :1,347.58 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formule :C93H159N35O25Masse moléculaire :2,167.52 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formule :C59H104N22O20Masse moléculaire :1,441.62 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS :Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H32N4O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :392.49 g/molHydroxybupropion
CAS :Produit contrôléHydroxybupropion is a drug that is used to treat depressive disorders. It acts as a nicotinic acetylcholine receptor antagonist and a dopamine uptake inhibitor, which increases the levels of dopamine in the brain. It is also an antidepressant with clinical response after oral administration. The plasma concentration-time curve of hydroxybupropion can be found by using both the conventional single-phase linear regression method and a nonlinear mixed effects model. This drug may interact with other drugs, such as antidepressants and antipsychotics, and has been shown to increase their levels in the blood stream. Hydroxybupropion also interacts with drugs that affect metabolism, such as α1-acid glycoprotein, or are taken up by the liver, such as acetylcholinesterase inhibitors. The chemical stability of hydroxybupropion can be determined by examining its stereoselectivity for acetylcholine receptors, which is dependent on pH.
Formule :C13H18ClNO2Degré de pureté :Min. 95%Masse moléculaire :255.74 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/molPergolide mesylate
CAS :Produit contrôléD1 and D2 dopamine agonist
Formule :C20H30N2O3S2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :410.6 g/molRef: 3D-FP26840
Produit arrêtéPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molH-His-Arg-OH
CAS :H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molMastoparan 7
Catalogue peptide; min. 95% purity
Formule :C67H124N18O15Masse moléculaire :1,421.85 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formule :C63H98N18O13SMasse moléculaire :1,347.66 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS :Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formule :C32H50N4O8Degré de pureté :Min. 95%Masse moléculaire :618.76 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molSiratiazem
CAS :Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.
Formule :C24H30N2O4SDegré de pureté :Min. 95%Masse moléculaire :442.57 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molALX-1393
CAS :ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.
Formule :C23H22FNO4Degré de pureté :Min. 95%Masse moléculaire :395.4 g/molhCG protein
The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes
Degré de pureté :Min. 95%1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid
CAS :Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C15H11NO4Degré de pureté :Min. 95%Masse moléculaire :269.25 g/molRef: 3D-AAC27331
Produit arrêtéCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
H-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molBodipy cyclopamine
CAS :Fluorescent derivative of cyclopamine
Formule :C49H70BF2N5O4Degré de pureté :Min. 95%Couleur et forme :Red SolidMasse moléculaire :841.92 g/molThymopentin acetate salt
CAS :Produit contrôléThymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.Formule :C30H49N9O9Degré de pureté :Min. 95%Masse moléculaire :679.77 g/molRef: 3D-FT109621
Produit arrêtéOligopeptide-51
Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Steroid Free Serum
Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.
Degré de pureté :Min. 95%8-(3-Chlorostyryl)caffeine
CAS :Produit contrôlé8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.
Formule :C16H15ClN4O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :330.77 g/molRef: 3D-XFA70011
Produit arrêté1,2-Dipalmitoyl-3-dimethylammonium-propane
CAS :1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.
Formule :C37H73NO4Degré de pureté :Min. 95%Masse moléculaire :595.98 g/molDNL343
CAS :a brain-penetrating activator of eukaryotic initiation factor 2B (eIF2B) that inhibits the abnormal integrated stress response
Formule :C20H19ClF3N3O4Masse moléculaire :457.83 g/molMS67N
CAS :Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C52H59F4N9O7SDegré de pureté :Min. 95%Masse moléculaire :1,030.14 g/molS 25585
CAS :S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing
Formule :C22H23F3N4O6SDegré de pureté :Min. 95%Masse moléculaire :528.5 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/molL-MobileTrex
CAS :L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.
Formule :C23H23N5O5Degré de pureté :Min. 95%Masse moléculaire :449.46 g/molCEA protein (Preservative-free)
Purified native Human CEA protein (Preservative-free)Degré de pureté :>95% By Sds-Page And ElectrophoresisCB-1158
CAS :CB-1158 is an arginase inhibitor, which is a small molecule derived from a synthetic source designed to modulate immune functions. Its mode of action involves the inhibition of the arginase enzyme, a key player in the urea cycle responsible for the hydrolysis of arginine into ornithine and urea. By blocking arginase, CB-1158 effectively prevents the depletion of extracellular arginine, a vital amino acid required for the activation and proliferation of T cells within the immune system. This inhibition leads to enhanced immune responses against tumors.
Formule :C11H22BN3O5Degré de pureté :Min. 95%Masse moléculaire :287.12 g/molRef: 3D-VID73206
Produit arrêtéPigment red 48 (C.I. 15865)
CAS :Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab
Formule :C18H11ClN2Na2O6SDegré de pureté :Min. 95%Masse moléculaire :464.79 g/molL 162389
CAS :L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.
Formule :C31H38N4O4SDegré de pureté :Min. 95%Masse moléculaire :562.7 g/mol1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine
CAS :1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine is a broad spectrum antimicrobial that has been shown to have binding properties to peptides. This compound can be used as a potential antimicrobial for the treatment of bacterial infections and gramicidin, an antibiotic that is active against bacteria. It has also been shown to permeabilize cell membranes, which may lead to its function as an antimicrobial agent. 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine is water soluble and has been shown to have conformational properties. These conformational properties are responsible for its binding activity with peptides. 1POGPE is stable in both calorimetric assays and bilayers, which allows it to maintain its structure when interacting with other compounds. 1POGPE also has a high affinity forFormule :C39H76NO8PDegré de pureté :Min. 95%Masse moléculaire :718 g/molRef: 3D-BBA66294
Produit arrêtéParainfluenza Virus Type 2 Antigen
Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.
There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.
Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.
Parainfluenza Virus Type 2 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-2 infection. It can also be used as a research tool in vaccine development.Degré de pureté :Min. 95%
