Produits biochimiques et réactifs

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAN antibody, catalog no. 70R-4075</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>

<p>Rat Prealbumin (TTR) ELISA Kit</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Bnc2 antibody, catalog no. 70R-8331</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>WZ4141 is a small molecule compound, which functions as a potent modulator of specific biological pathways. This compound is synthetically derived, offering researchers precise control over its experimental applications. It operates by selectively targeting and altering molecular interactions within cells, thereby influencing various signaling pathways that are critical for cellular functions.</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>Human Myoglobin ELISA Kit</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Human HMGB1(High mobility group protein B1) ELISA Kit</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>Denaverine hydrochloride is a research tool with the ability to activate receptors and ion channels. It has been used to study protein interactions and pharmacology. Denaverine hydrochloride has been shown to inhibit the activity of acetylcholine esterase, which is an enzyme that breaks down acetylcholine. This research tool has also been used as a ligand in antibody binding studies, and it is widely used in cell biology experiments for its ability to bind proteins. Denaverine hydrochloride is soluble in water and does not contain any impurities or toxic substances.</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%.</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>Biotin labeling kit for IgG</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Rabbit polyclonal PPARA antibody</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSENEN antibody, catalog no. 70R-9773</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>Quantify total bovine IgM in your samples.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>Pig Fibrinogen ELISA Kit</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Guinea Pig IgM ELISA Kit</p>

<p>Ac-Ala-Ala-Ala-pNA is a synthetic peptide that is derived from the natural amino acid sequence of cholecystokinin. It has been shown to have high affinity for phospholipid bilayers, which are lipid membranes that form the boundaries of cells and organelles. Ac-Ala-Ala-Ala-pNA can be used as a substrate molecule to study membrane permeability and selectivity in bioreactors. Ac-Ala-Ala-Ala-pNA also acts as a modulator of liposomal membranes, increasing the permeability of these membranes in order to allow more substrate molecules to pass through them.</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>