Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.115 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.722 produits)
- Métabolites secondaires(14.222 produits)
130582 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HSPB1
<p>HSPB1, also known as heat shock protein beta-1, is a protein that plays a crucial role in various life sciences processes. It has been shown to interact with α-synuclein, elastase protein, fibrinogen, and inhibitors. HSPB1 also regulates ferroptosis and myostatin levels in the body. Additionally, it has been found to have interactions with circumsporozoite protein, natriuretic peptides, glp-1, hemoglobin, and lipoprotein lipase. Antibodies against HSPB1 can be used for research purposes or diagnostic applications related to diseases involving alpha-synuclein.</p>CLDN9 antibody
<p>CLDN9 antibody is a highly specific and sensitive tool used in scientific research to target the caspase-9 oncogene homolog. This antibody can be used in various applications, including cholinergic studies and electrode-based assays. It has been extensively tested and validated for its specificity, ensuring accurate and reliable results.</p>Chk1 antibody
<p>The Chk1 antibody is a highly effective monoclonal antibody that has the ability to neutralize superoxide, a harmful free radical that can cause oxidative damage to cells. This antibody specifically targets and binds to Chk1, a protein involved in cell cycle regulation and DNA repair. By binding to Chk1, the antibody prevents its activation and inhibits its function, leading to cell cycle arrest and increased sensitivity to DNA-damaging agents. Additionally, this antibody has been shown to have cytotoxic effects on cancer cells, making it a potential therapeutic option for cancer treatment. With its high specificity and potency, the Chk1 antibody is a valuable tool for researchers studying cell cycle regulation and exploring novel cancer therapies.</p>1,2-Di-o-phytanyl-sn-glycero-3-phosphoethanolamine
CAS :<p>1,2-Di-o-phytanyl-sn-glycero-3-phosphoethanolamine is a synthetic molecule that has been shown to mimic the function of lipids. 1,2-Di-o-phytanyl-sn-glycero-3-phosphoethanolamine is an amphiphilic compound with a hydrophilic head and hydrophobic tail. It has been shown to form stable bilayers in water, which may be due to its ability to form hydrogen bonds with water molecules. It is also able to form self assembled monolayers at the air/water interface. This dispersive molecule has been shown in microscopy experiments to reduce the thickness of lipid bilayers by up to 50% and increase their permeability by up to ten times.<br>1,2 Di o phytanyl sn glycero 3 phosphate ethanolamine has also been used as a biosensor for ionic liquids due its ability to bind</p>Formule :C45H94NO6PDegré de pureté :Min. 95%Masse moléculaire :776.2 g/molFactor IX antibody
<p>Factor IX antibody was raised in goat using human Factor IX as the immunogen.</p>Degré de pureté :Min. 95%1,2-Docosahexanoyl-SN-glycero-3-phosphocholine, in Chloroform, 10mg/ml
CAS :<p>Docosahexanoyl-sn-glycero-3-phosphocholine (DHA) is a dietary phospholipid that has been shown to have biological activity in several animal models. DHA is a polyunsaturated fatty acid that can be found in the brain and muscle tissue. DHA is important for maintaining the integrity of cellular membranes, which are biomimetic lipid bilayers. These structures make up the outer layer of cells and allow for communication between cells and other molecules outside of the cell membrane. DHA has been shown to delay neurodegenerative diseases such as Alzheimer's disease by preventing oxidative damage to neurons.</p>Formule :C52H80NO8PDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :878.17 g/molCD8 antibody
<p>The CD8 antibody is a highly specialized monoclonal antibody used in various immunoassays and life sciences research. It is designed to specifically target and bind to the CD8 antigen, which is expressed on the surface of activated T cells and natural killer cells. This antibody can be used in flow cytometry, immunohistochemistry, and other techniques to detect and quantify CD8-positive cells.</p>BMI1 antibody
<p>The BMI1 antibody is a highly specialized monoclonal antibody that has been isolated for its cytotoxic properties. It specifically targets the BMI1 protein, which plays a crucial role in cell proliferation and self-renewal. By neutralizing the activity of BMI1, this antibody effectively inhibits the growth and survival of cancer cells.</p>TMLHE Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMLHE antibody, catalog no. 70R-2479</p>Degré de pureté :Min. 95%ZNF280C antibody
<p>ZNF280C antibody was raised in rabbit using the N terminal of ZNF280C as the immunogen</p>Degré de pureté :Min. 95%Goat anti Rat IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Degré de pureté :Min. 95%Etravirine D4
CAS :<p>Etravirine D4 is an antiviral agent that inhibits the enzyme reverse transcriptase, which is necessary for the replication of HIV. It is a phosphonate analog that has been shown to be active against a number of mutant strains of HIV. Etravirine D4 has been shown to have immunosuppressive effects as it decreases CD4+ T-cell counts and reduces the production of cytokines. The drug can also cause severe side effects in humans, including hypersensitivity reactions such as toxic epidermal necrolysis, autoimmune disorders, and pediatric diseases. Etravirine D4 should not be used in patients with AIDS or other immunodeficiency disorders.</p>Formule :C20H15BrN6ODegré de pureté :Min. 95%Masse moléculaire :439.3 g/molPPARG antibody
<p>PPARG antibody was raised in Mouse using a purified recombinant fragment of PPARG(aa170-270) expressed in E. coli as the immunogen.</p>TM4SF20 antibody
<p>TM4SF20 antibody was raised using the middle region of TM4SF20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG</p>Degré de pureté :Min. 95%EBI3 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>PPP2R3B antibody
<p>PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ</p>Degré de pureté :Min. 95%p70S6 Kinase antibody
<p>The p70S6 Kinase antibody is a powerful tool used in scientific research to study various cellular processes. This antibody specifically targets and binds to p70S6 Kinase, a protein involved in cell growth and proliferation. By binding to this protein, the antibody allows researchers to visualize and analyze its activity within cells.</p>Degré de pureté :Min. 95%Inflachromene
CAS :<p>Inflachromene is a molecule that is structurally related to the triterpenoid saponins. It has been found to have immunomodulatory effects on microglia, and it has been suggested that this may be due to its ability to induce autophagy. Inflachromene has also been found to stabilize chemical bonds by forming disulfide bonds, which can be used in sample preparation for analysis. The stability of inflachromene was observed in cell cultures as well as in human liver samples. The molecule has also been shown to have an effect on toll-like receptors (TLRs) and may be an effective treatment for autoimmune diseases such as multiple sclerosis.</p>Formule :C21H19N3O4Degré de pureté :Min. 95%Masse moléculaire :377.4 g/molFOXO4 antibody
<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>AK2 antibody
<p>AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT</p>B4GALT2 antibody
<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR</p>Degré de pureté :Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
<p>Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>Degré de pureté :Min. 95%BHMT antibody
<p>BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT</p>Semenogelin I Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEMG1 antibody, catalog no. 70R-1587</p>Degré de pureté :Min. 95%GIP (1-39)
CAS :<p>GIP (1-39) is an inhibitor of the GIP receptor. It is a research tool used in the study of cell biology and peptides, as well as pharmacology, ligands, and ion channels. GIP (1-39) is also an activator of the GIP receptor. This protein has been shown to have high purity with a specific activity at least 5 times that of other sources.</p>Formule :C210H316N56O61SDegré de pureté :Min. 95%Masse moléculaire :4,633 g/molNormal Syrian Hamster Serum
<p>Normal Syrian Hamster Serum which has been lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2</p>Degré de pureté :Min. 95%Myosin 7 antibody
<p>Myosin 7 antibody was raised in rabbit using the middle region of Myosin 7 as the immunogen</p>Degré de pureté :Min. 95%C7orf16 antibody
<p>C7orf16 antibody was raised in rabbit using the middle region of C7orf16 as the immunogen</p>Degré de pureté :Min. 95%Rotavirus antibody
<p>Rotavirus antibody was raised in mouse using p41 capsid protein of monkey, porcine and human isolates as the immunogen.</p>IGF1R antibody
<p>IGF1R antibody was raised in Mouse using a purified recombinant fragment of IGF1R expressed in E. coli as the immunogen.</p>OCEL1 antibody
<p>OCEL1 antibody was raised in rabbit using the C terminal of OCEL1 as the immunogen</p>Degré de pureté :Min. 95%Opticin antibody
<p>Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED</p>Degré de pureté :Min. 95%Mouse anti Human IgG antibody
<p>Mouse anti Human IgG antibody was raised in Mouse using Human IgG was isolated from human sera and purified by chromatography as the immunogen.</p>CLASP1 antibody
<p>CLASP1 antibody was raised in Rat using alpha-CLASP1-N-terminus and GST fusion protein as the immunogen.</p>Tropomyosin 3 antibody
<p>Tropomyosin 3 antibody was raised using the middle region of TPM3 corresponding to a region with amino acids TEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKIL</p>Donkey anti Goat IgG (H + L) (HRP)
<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>Degré de pureté :Min. 95%C12ORF4 antibody
<p>C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS</p>Goat anti Mouse λ Light Chain (HRP)
<p>Goat anti Mouse Lambda Light Chain secondary antibody (HRP)</p>RFESD Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RFESD antibody, catalog no. 70R-4404</p>Degré de pureté :Min. 95%ALAS2 antibody
<p>ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA</p>OR51E1 antibody
<p>The OR51E1 antibody is a highly effective neutralizing agent used in Life Sciences research. It has been extensively tested and validated through electrophoresis techniques. This antibody specifically targets e-cadherin, fibrinogen, erythropoietin, chemokine, collagen, interleukin-6, and actin.</p>HER2 antibody
<p>The HER2 antibody is a highly effective medicament that acts as an anti-HER2 antibody. It works by targeting the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. This biochemical agent belongs to the class of monoclonal antibodies, similar to adalimumab and trastuzumab. The HER2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth.</p>YAP antibody
<p>The YAP antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects the Yes-associated protein (YAP). YAP is an important growth factor involved in various cellular processes, including cell proliferation and differentiation.</p>CD49e antibody (Azide Free)
<p>CD49e antibody (Azide Free) was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/9 as the immunogen.</p>Adenovirus Type 2 protein
<p>Adenovirus Type 2 protein is a versatile protein that has various applications in the field of Life Sciences. It is commonly used in research and diagnostic laboratories for its ability to generate antibodies through hybridoma cell lines. This protein can be used as a heterologous polypeptide to study the immune response or as an antigen to develop diagnostic tests.</p>Degré de pureté :Min. 95%Abcb10 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Abcb10 antibody, catalog no. 70R-8569</p>Degré de pureté :Min. 95%RTN4 antibody
<p>RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV</p>Degré de pureté :Min. 95%METTL2B antibody
<p>METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS</p>IgG Isotype Control antibody (biotin)
<p>Syrian Hamster monoclonal IgG Isotype Control antibody (biotin)</p>Degré de pureté :Min. 95%Goat anti Mouse IgG + IgA + IgM (H + L) (biotin)
<p>Goat anti-mouse IgG/IgA/IgM (H+L) (biotin) was raised in goat using murine IgG, IgA and IgM whole molecules as the immunogen.</p>Degré de pureté :Min. 95%TPX2 antibody
<p>TPX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK</p>Degré de pureté :Min. 95%SCG2 antibody
<p>SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ</p>IL13 antibody
<p>IL13 antibody was raised in rabbit using highly pure recombinant murine IL-13 as the immunogen.</p>Degré de pureté :Min. 95%GLUT12 antibody
<p>GLUT12 antibody was raised in rabbit using a 15 amino acid peptide from human GT122 as the immunogen.</p>Degré de pureté :Min. 95%TRIM32 antibody
<p>The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.</p>Lyrm4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Lyrm4 antibody, catalog no. 70R-9499</p>Degré de pureté :Min. 95%Uhmk1 antibody
<p>Uhmk1 antibody was raised in rabbit using the C terminal of Uhmk1 as the immunogen</p>Degré de pureté :Min. 95%PLCG2 antibody
<p>The PLCG2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets PLCG2, an enzyme involved in various cellular processes. This antibody has been widely used to study the role of PLCG2 in signal transduction pathways and its association with diseases.</p>Collagen Type XI α 2 antibody
<p>Collagen Type XI Alpha 2 antibody was raised using the N terminal of COL11A2 corresponding to a region with amino acids TADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSG</p>Degré de pureté :Min. 95%ADCY2 antibody
<p>ADCY2 antibody was raised in rabbit using the middle region of ADCY2 as the immunogen</p>Degré de pureté :Min. 95%Alkaline Phosphatase antibody
<p>Alkaline phosphatase antibody was raised in mouse using human placental alkaline phosphatase as the immunogen.</p>AQP1 antibody
<p>The AQP1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It has been shown to inhibit the multidrug resistance protein and enhance the expression of E-cadherin, a cell adhesion molecule. This antibody specifically targets AQP1, which is a water channel protein involved in various physiological processes. The AQP1 antibody has been extensively used in life sciences research to study its role in different cellular pathways. Additionally, it has been found to have cytotoxic effects on cancer cells and can interfere with nuclear signaling pathways. Its potential as a therapeutic agent is being explored in various fields, including oncology and immunology.</p>LIX protein (Mouse)
<p>Region of LIX protein corresponding to amino acids TELRCVCLTV TPKINPKLIA NLEVIPAGPQ CPTVEVIAKL KNQKEVCLDP EAPVIKKIIQ KILGSDKKKA.</p>Degré de pureté :Min. 95%C-myc antibody (HRP)
<p>C-myc antibody (HRP) was raised in goat using a synthetic peptide representing amino acid residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>FGFR3 antibody
<p>The FGFR3 antibody is a histidine-rich interferon family kinase inhibitor that is widely used in the Life Sciences field. It possesses strong inhibitory properties, particularly against diacylglycerol, making it an effective tool for studying various cellular processes. This monoclonal antibody specifically targets and binds to the glycoprotein FGFR3, blocking its activity and preventing the activation of downstream signaling pathways. By inhibiting FGFR3, this antibody can interfere with epidermal growth factor-mediated cell proliferation and survival. Additionally, it has cytotoxic effects on cancer cells that overexpress FGFR3, making it a potential therapeutic option for certain types of cancers. The FGFR3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with versatile tools for their experiments.</p>PF 3274167
CAS :<p>Antagonist of oxytocin receptor</p>Formule :C19H19ClFN5O3Degré de pureté :Min. 95%Masse moléculaire :419.84 g/molGranulysin antibody
<p>Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP</p>CMV antibody
<p>CMV antibody was raised in mouse using a 66 kDa antigen appearing in the cytoplasm and nucleus. as the immunogen.</p>BEND7 antibody
<p>BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV</p>
