Produits biochimiques et réactifs

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Rat monoclonal T and B cell activation antigen antibody</p>

<p>Plectin antibody was raised in guinea pig using the C-Terminal “C” domain of recombinant human plectin as the immunogen.</p>

<p>Purified recombinant IL36G protein (His tag)</p>

<p>Mouse monoclonal TAF2 antibody</p>

<p>SLC9A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids INYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQT</p>

<p>Rabbit polyclonal SF3B2 antibody</p>

<p>The IgM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule called mesothelin, which is found in the nucleus of cells. This antibody has cytotoxic properties and can effectively neutralize the urokinase plasminogen activator, which plays a role in cell migration and invasion.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG</p>

<p>Armenian Hamster monoclonal CD119 antibody (PE)</p>

<p>Mouse monoclonal CD3 antibody (biotin)</p>

<p>CD44 Monoclonal Antibody (FITC)</p>

<p>GPR151 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.</p>

<p>Rabbit polyclonal AP2A1 antibody</p>

<p>HAAO antibody was raised using the N terminal of HAAO corresponding to a region with amino acids HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG</p>

<p>The VASP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF)-like domain of VASP (Vasodilator-stimulated phosphoprotein), a protein involved in cell adhesion and migration. This antibody has been extensively characterized and validated for its high specificity and affinity towards VASP.</p>

<p>Rabbit polyclonal NR2C1 antibody</p>

<p>Rabbit polyclonal GPR62 antibody</p>

<p>The IL17F antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and neutralize the effects of IL17F, an important cytokine involved in various inflammatory processes. This antibody has been extensively tested and proven to effectively block IL17F activity, making it a valuable asset in research and therapeutic applications.</p>

<p>The EpCAM antibody is a monoclonal antibody that has been developed through recombinant technology. It specifically targets the epithelial cell adhesion molecule (EpCAM), which is expressed on the surface of various types of cancer cells. By binding to EpCAM, this antibody inhibits the growth and spread of cancer cells.</p>

<p>Mouse monoclonal XRCC1 antibody</p>

<p>PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV</p>

<p>Chlamydia pneumoniae antibody was raised in Mouse using Chlamydia pneumoniae (TWAR) as the immunogen.</p>

<p>ATP6V1B1 antibody was raised using the middle region of ATP6V1B1 corresponding to a region with amino acids LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL</p>

<p>The AKT1 antibody is a highly effective colloidal solution that contains monoclonal antibodies. These antibodies specifically target and bind to the AKT1 protein, which plays a crucial role in various cellular processes. By binding to AKT1, the antibody inhibits its activity and prevents the activation of downstream signaling pathways.</p>

<p>Purified recombinant Human CHI3L1 protein (His tag)</p>

<p>Purified native Bovine Factor X protein</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an advanced antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted on this drug using advanced techniques like the patch-clamp technique on human erythrocytes, proving its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CD11/CD18 Monoclonal Antibody</p>

<p>GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI</p>

<p>PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>The Beta galactosidase antibody is a neutralizing antibody used in Life Sciences research. It specifically targets and binds to the glycan structure of Beta galactosidase, an enzyme involved in glycosylation processes. This antibody is commonly used in biochemical studies to analyze the function and localization of Beta galactosidase in cells and tissues.</p>

<p>Rabbit polyclonal RIC8B antibody</p>

<p>Purified Polyclonal CSNK1G1 antibody</p>

<p>KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG</p>

<p>Rabbit polyclonal FHIT antibody (FITC)</p>

<p>LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV</p>

<p>The L1CAM antibody is a monoclonal antibody that has been specifically designed to target and bind to the L1 cell adhesion molecule. This molecule is found on the surface of various cells, including endothelial cells, and plays a crucial role in cell adhesion, migration, and signaling. The L1CAM antibody has been shown to be highly effective in inhibiting the activation of L1CAM and preventing its interaction with other molecules such as glutamate binding proteins, chemokines, fatty acids, collagen, and other biomolecules.</p>

<p>Mouse monoclonal Oncostatin M receptor antibody (PE)</p>

<p>The TP53 antibody is a monoclonal antibody used in life sciences research. It specifically targets the TP53 protein, also known as p53, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively studied in various applications, including the detection of TP53 mutations in cancer cells and the investigation of its interaction with other proteins.</p>

<p>Armenian Hamster monoclonal CD40 antibody (FITC)</p>

<p>Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal LKB1 antibody (Ser428)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF589 antibody, catalog no. 70R-8218</p>

<p>GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI</p>

<p>Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ</p>

<p>Rabbit polyclonal CXG2 antibody</p>

<p>Purified recombinant Human BCL2L11 protein (His tag)</p>

<p>ZNF101 antibody was raised in rabbit using the N terminal of ZNF101 as the immunogen</p>

<p>Purified Polyclonal SH3GLB2 antibody</p>

<p>SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>Mouse monoclonal SBDS antibody</p>

<p>Mouse monoclonal PP1A antibody</p>

<p>CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.</p>

<p>ABHD2 antibody was raised using the middle region of ABHD2 corresponding to a region with amino acids RESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADR</p>

<p>Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING</p>

<p>LOC202759 antibody was raised in rabbit using the middle region of LOC202759 as the immunogen</p>

<p>NT5M antibody was raised using the N terminal of NT5M corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL</p>

<p>Mouse monoclonal TUBAL3 antibody</p>

<p>Rabbit polyclonal Myoglobin antibody (biotin)</p>

<p>Mouse monoclonal PAIP2 antibody</p>

<p>Rabbit polyclonal RFC3 antibody</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.</p>

<p>Prasugrel is an organic compound that belongs to the inorganic class of compounds. It has a polymorphic nature and has been shown to have anticoagulant properties. Prasugrel is a prodrug that is hydrolyzed in vivo to produce maleic acid, its active form. Maleic acid inhibits platelet aggregation by inhibiting the action of thrombin, which converts fibrinogen into fibrin. The antiplatelet effect of prasugrel can be enhanced by combining it with other drugs such as clopidogrel or aspirin.</p>

<p>ABC-1183 is a peptide that acts as an activator of the ion channel. It is a high purity and highly concentrated peptide that can be used in research to study protein interactions. ABC-1183 can be used as an inhibitor of the ligand or receptor, and has been shown to inhibit the activity of ion channels. This peptide may also be used in pharmacology, where it is able to block specific ion channels.</p>

<p>(S)-Aminoglutethimide tartrate is a ligand that binds to the GABA receptor and blocks the ion channels. It has been used as a research tool for studying the structure of ion channels, as well as for identifying ligands that bind to specific receptors. (S)-Aminoglutethimide tartrate has also been shown to be an inhibitor of protein interactions. This drug has not yet been approved by the Food and Drug Administration for any use in humans.</p>

<p>Please enquire for more information about N-Benzyl-6-((4-phenylbutan-2-yl)oxy)hexan-1-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Simetride is a pharmacological agent that belongs to the group of ligands. It binds to and activates ion channels, which are membrane-spanning proteins that allow ions to pass across the cell membrane. Simetride is a high-purity drug with a CAS number of 154-82-5. It has been used as an experimental tool in cell biology and biochemistry laboratories for over 30 years.</p>

<p>NAS-181 is a drug that inhibits the voltage-dependent calcium channels. It has been shown to be effective in reducing pain and inflammation from chronic headaches. NAS-181 is a non-selective antagonist of 5-HT1A and 5-HT1B receptors, which are both linked to the transmission of pain signals from the central nervous system. NAS-181 also affects neurotransmission by inhibiting glutamate release in the brain and monoamine neurotransmitters such as dopamine. This drug has been shown to inhibit neuronal activity in the mouse striatum, an area associated with motor control, cognition, and mood regulation.<br>br&gt;br&gt;<br>This drug is being developed for the treatment of migraine headaches.br&gt;br&gt;</p>

<p>CEP-28122 is a selective and potent small-molecule inhibitor, which is derived from chemical synthesis targeting receptor tyrosine kinases, specifically the fibroblast growth factor receptors (FGFRs). Its mode of action involves the competitive inhibition of ATP binding, thereby preventing the phosphorylation cascade necessary for signal transduction downstream of FGFRs. By inhibiting these pathways, CEP-28122 effectively impedes processes such as cell proliferation and angiogenesis, which are critical in various pathological conditions including cancer.</p>

<p>Camellianin B is a potent inhibitor of kinase activity that has been found in urine and is an analog of the natural product Camellianin A. This compound has been shown to induce apoptosis in Chinese hamster ovary cells and human leukemia cells, making it a promising candidate for medicinal use in cancer treatment. Camellianin B inhibits the cell cycle by targeting specific proteins involved in tumor growth, making it an effective inhibitor of cancer cell proliferation. Its potential as a therapeutic agent for cancer treatment is currently being investigated.</p>

<p>5-Bromo-N-[1-(3-cyclopropyl-1,2,4-oxadiazol-5-yl)cyclohexyl]-2-furamide is a synthetic compound, which is often classified as a small molecule inhibitor or modulator, widely utilized in biochemical and pharmacological research. This compound is typically derived through a series of intricate organic synthesis processes involving selective bromination and cyclization steps that yield its unique structure, with features such as a bromine atom and a cyclopropyl group contributing to its specific biochemical properties.</p>

<p>Glucokinase activator, cpd A is a peptide that can be used as a research tool. The protein interacts with the glucokinase receptor and inhibits it, which is a key enzyme in carbohydrate metabolism. Glucokinase activator, cpd A has been shown to inhibit ion channels, and is an inhibitor of the alpha-subunit of the GABA receptor. It also binds to a number of other receptors. This product has high purity and is CAS No. 603108-44-7.</p>

<p>Amosulalol is a potent, non-selective antagonist of β-adrenoceptors. It is used for the treatment of hypertension and heart failure. Amosulalol binds to β-adrenoceptors in both the diastolic (relaxing) and systolic (contracting) phases of the cardiac cycle, thereby inhibiting the effects of catecholamines. In addition, it has been shown to inhibit cyclase activity and reduce blood pressure in animal models by reducing the activity of renin. Amosulalol also has anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>

<p>KU 59403 is a potent inhibitor that functions as an anti-proliferative agent, targeting specific biochemical pathways. Developed through chemical synthesis, it primarily acts as an inhibitor of DNA-dependent protein kinase (DNA-PK). This kinase is integral to the non-homologous end joining (NHEJ) pathway, responsible for repairing double-strand breaks in DNA.</p>

<p>RS 504393 is a potent and selective antagonist of Toll-like receptor 4 (TLR4) that has been shown to inhibit the production of proinflammatory cytokines, chemokines, and nitric oxide. RS 504393 has been shown to be effective in the treatment of bone cancer, as well as in the prevention of renal injury due to tubulointerstitial damage. This drug has also been shown to have anti-inflammatory effects in a model system through inhibition of chemokine production. RS 504393 is an ester hydrochloride salt that binds with high affinity to TLR4 receptors, inhibiting receptor activity by preventing ligand binding.</p>

<p>Prostaglandin E2 receptor 2 (EP2) agonist; therapeutic use in ocular dysfuntions</p>

<p>MS012 is a butyric acid-producing bacteria that was isolated from the roots of S. rebaudiana. It has shown bacteriostatic activity against Gram-positive and Gram-negative bacteria, and it also has inhibitory effects on cancer cells. MS012 produces butyric acid, which is an important signaling molecule for cell growth regulation. The homologous protein sequence of MS012 is highly conserved and belongs to histone H3 family, which plays a key role in regulating gene expression in eukaryotic cells. MS012 has been shown to have potential as a cancer therapy due to its ability to induce histone methylation and increase e3 ubiquitin levels.</p>

<p>Nociceptin is a neuropeptide that acts as an endogenous ligand for the opioid receptor. It has been shown to be an antagonist of opioid receptors, although it also activates potassium channels. Nociceptin has been used as a research tool in pharmacology and protein interactions, where it has been shown to inhibit the binding of opioid receptor-specific antibodies and to activate potassium-selective ion channels. Nociceptin is a high purity peptide with CAS No. 205252-57-9.</p>

<p>XMD8-87 is a cancer drug under development by Novartis that inhibits the growth of tumor cells by blocking the activity of kinases. XMD8-87 is selective for SRC family kinases and has been shown to inhibit the growth of tumor cells in vitro and in vivo. The drug has also been shown to have an effect on other types of cancer cells, including lung, colon, prostate, and breast cancers. XMD8-87 binds to a region targeted by many drugs that are currently used for cancer treatment, including dasatinib and imatinib. This may make it possible to use XMD8-87 as a substitute or complementary treatment option.</p>

<p>Daglutril is a drug which inhibits the enzyme 11-beta-hydroxylase. It has been shown to have an inhibitory effect on humans with cavity, which is due to its ability to inhibit mineralocorticoid receptor and angiotensin system. Daglutril also has an atrial primary analysis effect that is demonstrated in diabetic patients with chronic kidney disease and ventricular dysfunction. Monoclonal antibodies are used for this drug's administration, as it binds to human glycoprotein hormones such as insulin and glucagon, preventing them from binding to their receptors. Daglutril is also effective for metabolic disorders such as type 2 diabetes.</p>

<p>SID 26681509 is an enzyme inhibitor that inhibits toll-like receptor (TLR) signaling pathways. TLRs are a family of proteins that act as pattern recognition receptors for the detection of microbial or viral components. SID 26681509 has been shown to inhibit HIV infection in primary cells and to induce autophagy, which may be due to its ability to inhibit methyl transferase activity. It also has been shown to reduce inflammation in mouse models of autoimmune diseases by inhibiting chemoattractant protein expression.</p>

<p>3-(4-{4-Aminofuro[2,3-d]pyrimidin-5-yl}phenyl)-1-[2-fluoro-5-(trifluoromethyl)phenyl]urea is an inhibitor of ion channels. It is a ligand that binds to the receptor site on ion channels and blocks them. The protein interactions of 3-(4-{4-aminofuro[2,3-d]pyrimidin-5-yl}phenyl)-1-[2-fluoro-5-(trifluoromethyl)phenyl]urea are not yet known. This drug has been shown to have a high purity, often greater than 99%. The CAS number for this drug is 501693-48-.</p>

<p>Rabbit polyclonal OR6P1 antibody</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>Rabbit polyclonal RNMTL1 antibody</p>

<p>Calmodulin antibody was raised in mouse using recombinant human Calmodulin (1-149aa) purified from E. coli as the immunogen.</p>

<p>The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.</p>

<p>MAB21L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR</p>

<p>Rabbit polyclonal FTL antibody (FITC)</p>

<p>The Cortisol monoclonal antibody is a specialized antibody used in the field of Life Sciences. It has been developed to specifically target and bind to cortisol, a hormone that plays a crucial role in various physiological processes. This antibody is widely used in research and diagnostic applications to detect and measure cortisol levels in different biological samples.</p>

<p>Purified recombinant PLIN2 protein (His tag)</p>

<p>TMEM176A antibody was raised using the middle region of TMEM176A corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ</p>