Produits biochimiques et réactifs

<p>Mouse monoclonal CP15 antibody</p>

<p>Rabbit polyclonal OR10C1 antibody</p>

<p>Purified recombinant CCL3 protein (His tag)</p>

<p>Rat monoclonal CD24 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX6 antibody, catalog no. 70R-1805</p>

<p>The POU2F1 antibody is a highly specialized antibody that targets the POU2F1 protein. This protein plays a crucial role in various biological processes, including cell growth, differentiation, and development. The antibody specifically recognizes and binds to the POU2F1 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN</p>

<p>Clenbuterol-BSA</p>

<p>Rabbit polyclonal XRCC3 antibody</p>

<p>Cacng8 antibody was raised in rabbit using the middle region of Cacng8 as the immunogen</p>

<p>Mouse monoclonal GABPB2 antibody</p>

<p>Mycoplasma pneumoniae protein is a neutralizing protein that plays a crucial role in combating infections caused by Mycoplasma pneumoniae. This protein has been extensively studied and is known for its ability to inhibit the growth of Mycoplasma pneumoniae, a common respiratory pathogen. It acts by binding to specific receptors on the surface of the bacteria, preventing their attachment and subsequent invasion of host cells.</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV</p>

<p>Rabbit polyclonal WRKY62.2 antibody</p>

<p>Rabbit Polyclonal Vimentin antibody (Ser83)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>ZNF200 antibody was raised in rabbit using the middle region of ZNF200 as the immunogen</p>

<p>TNFRSF10B antibody is a polyclonal antibody that specifically targets the TNFRSF10B protein. This protein is found in the nucleus and adipose tissues and plays a crucial role in various biological processes. The TNFRSF10B antibody is designed to neutralize the activity of TNFRSF10B, making it an essential tool for research in the life sciences field.</p>

<p>Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>Recombinant Human CYP2E1 protein (His tag)</p>

<p>Purified recombinant MINA protein (His tag)</p>

<p>PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD</p>

<p>PDPN antibody was raised in mouse using recombinant human PDPN (1-206aa) purified from E. coli as the immunogen.</p>

<p>KIN antibody was raised in Rabbit using Human KIN as the immunogen</p>

<p>Affinity purified rabbit CYBB antibody</p>

<p>Rabbit polyclonal EEF1G antibody</p>

<p>The p53 antibody is a highly specialized antibody that is capable of detecting and binding to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing the formation of tumors. The p53 antibody is specifically designed to target and bind to the activated form of the p53 protein, making it an invaluable tool for researchers studying cancer and other diseases.</p>

<p>Gephyrin antibody was raised using the N terminal of GPHN corresponding to a region with amino acids HDELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTED</p>

<p>Rabbit polyclonal BSK3 antibody</p>

<p>LAT antibody is a monoclonal antibody that specifically targets amyloid plaque, which is a hallmark of various neurodegenerative diseases. It has been shown to have cytotoxic effects on amyloid-beta peptide, the main component of these plaques. LAT antibody works by binding to the amyloid-beta peptide and promoting its clearance from the brain.</p>

<p>PSP antibody was raised in mouse using recombinant human PSP (1-225aa) purified from E. coli as the immunogen.</p>

<p>Rod1 antibody was raised in rabbit using the N terminal of Rod1 as the immunogen</p>

<p>xNopp180 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.</p>

<p>BMP4 antibody was raised in mouse using highly pure recombinant human BMP-4 as the immunogen.</p>

<p>Rabbit polyclonal RAB39B antibody</p>

<p>Purified Rabbit polyclonal PDCD10 antibody</p>

<p>Purified Rabbit polyclonal GUSBL1 antibody</p>

<p>DKFZP564O0523 antibody was raised using the C terminal of DKFZP564O0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL</p>

<p>The MAGE antibody is a low-molecular-weight antiviral agent that is used to detect specific proteins in blood plasma. It belongs to the class of Monoclonal Antibodies, which are highly specific antibodies produced by identical immune cells. The MAGE antibody can be used in various applications, including syncytia formation assays and detection of specific proteins in diagnostic tests.</p>

<p>Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogen</p>

<p>The GAPDH antibody is a highly specific monoclonal antibody that targets glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody is widely used in life sciences research to detect and quantify GAPDH levels in various samples, including blood plasma and isolated nucleic acids.</p>

<p>Mouse Red Blood Cells are a valuable resource in various research applications. These cells play a crucial role in studying the effects of different factors on cell growth and development. Mouse Red Blood Cells contain important molecules such as dopamine, growth factors, necrosis factor-related apoptosis-inducing ligands, and chemokines that are involved in various biological processes. One of the key characteristics of Mouse Red Blood Cells is their ability to induce hemolysis. This property makes them ideal for studying the effects of different substances on cell membrane integrity and function. Additionally, Mouse Red Blood Cells have been used in veterinary applications to study the anti-vascular endothelial growth factor (anti-VEGF) activity of certain compounds. Researchers have also utilized Mouse Red Blood Cells to investigate the potential therapeutic properties of monoclonal antibodies like adalimumab. These antibodies have shown antiangiogenic effects, making them promising candidates for treating various diseases. Furthermore, Mouse Red Blood Cells can be used to study protein kinase inhibitors and their impact on</p>

<p>The FYN antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostic applications to detect and study GFAP expression. GFAP is an intermediate filament protein that is highly expressed in astrocytes, a type of glial cell in the central nervous system. The FYN antibody can be used to visualize and quantify GFAP levels in various tissues and cell types, providing valuable insights into the role of astrocytes in neurological diseases and disorders.</p>

<p>Factor X antibody is a polyclonal antibody that specifically targets Factor X, an essential protein involved in the blood clotting cascade. This antibody is derived from adeno-associated virus and has been shown to have high affinity and specificity for Factor X. It can be used in various life science applications, such as research studies on blood coagulation, as well as in the development of anti-neoplastic agents with antiangiogenic activity. Additionally, this antibody has been found to inhibit lipid peroxidation, which may have implications in preventing oxidative damage. With its unique properties and potential therapeutic applications, Factor X antibody is a valuable tool for researchers and clinicians alike.</p>

<p>AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.</p>

<p>B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY</p>

<p>Rabbit polyclonal M2A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable tool in the fight against tuberculosis.</p>

<p>Mouse monoclonal IFI35 antibody</p>

<p>Transferrin protein is a versatile monoclonal antibody that has various applications in the field of life sciences. It plays a crucial role in cell growth and development by binding to specific molecules and promoting cellular processes. Transferrin protein is commonly used as a carrier for targeted drug delivery, especially in combination with trastuzumab, an anti-HER2 antibody. The protein contains an amino group that can be conjugated with different molecules, such as fatty acids or other monoclonal antibodies, to enhance its functionality.</p>

<p>CCNB1IP1 antibody was raised in mouse using recombinant Human Cyclin B1 Interacting Protein 1 (Ccnb1Ip1)</p>

<p>PDGFRalpha kinase inhibitor 1 is an inhibitor of the PDGFRalpha protein. The PDGFRalpha protein is a receptor tyrosine kinase that belongs to the group of receptors that are activated by specific growth factors and cytokines. This inhibitor has affinity for the active site of PDGFRalpha, where it binds and blocks the catalytic activity of this enzyme.<br>PDGFRalpha kinase inhibitor 1 is a potent, selective and reversible inhibitor of PDGFRα with IC50 value in low micromolar range. It does not inhibit other tyrosine kinases such as PDGFRA, AXL, RET or KIT.</p>

<p>Armenian Hamster monoclonal CD27 antibody (biotin)</p>

<p>Oxycodone antibody was raised in mouse using oxycodone-BSA as the immunogen.</p>

<p>The HCK antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the HCK protein, which is found in human hepatocytes. This antibody has been shown to have cytotoxic effects on cells expressing high levels of HCK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The HCK antibody can also be immobilized on an electrode for use in biosensor applications. In addition, this antibody has been used in studies investigating the role of interferon and CXCR4 binding proteins in cell signaling pathways. Its binding properties are highly specific to the acidic chemokine receptors expressed on human serum.</p>

<p>Rabbit polyclonal XRCC1 antibody</p>

<p>CARS antibody was raised in Rabbit using Human CARS as the immunogen</p>

<p>The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.</p>

<p>Rabbit polyclonal BTK antibody (Tyr223)</p>

<p>Please enquire for more information about MDL-29951 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ONO-7300243 is a hydrogen bond inhibitor that has been shown to have anti-fungal activity. This drug is being studied for its potential use in the treatment of HIV infection. ONO-7300243 blocks the binding of nitro groups to monoclonal antibodies, which prevents their aggregation and allows them to be used as therapeutic drugs against HIV. The mechanism of action for this drug is not fully understood, but it is thought that ONO-7300243 may inhibit the synthesis or release of inflammatory cytokines such as TNF alpha and IL-1 beta. It also binds to the CB2 receptor and MT2 receptors, which are found on immune cells, suggesting an immunosuppressive effect. ONO-7300243 has been shown to have pharmacokinetic properties that are different from other drugs in its class; it has a long half-life and low clearance rate. There are also studies showing that ONO-7300243 has fatty acid</p>

<p>PDGF BB antibody was raised in rabbit using highly pure recombinant human PDGF-BB as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC6B antibody, catalog no. 70R-3155</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>Purified recombinant HBQ1 protein (His tag)</p>

<p>OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV</p>

<p>Rabbit polyclonal RIC8A antibody</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>Rabbit polyclonal CD124 antibody (Tyr497)</p>

<p>The BECN1 antibody is a monoclonal antibody that has been specifically designed to target and bind to the BECN1 protein. This protein plays a crucial role in autophagy, which is the process by which cells break down and recycle their own components. By binding to BECN1, this antibody activates the autophagy pathway, leading to increased cell survival and improved cellular function.</p>

<p>SCGB1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQKPRESIIKLMEKIA</p>

<p>Rabbit Polyclonal ABCA13 antibody</p>

<p>MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT</p>

<p>The AID antibody is a highly specialized monoclonal antibody that targets the adeno-associated virus (AAV). It specifically binds to insulin and has cytotoxic properties, making it effective in the treatment of insulin-related disorders. The AID antibody works by inhibiting the activity of reactive 3-kinase, an enzyme involved in insulin signaling pathways. This inhibition leads to a decrease in insulin production and secretion, ultimately resulting in improved glucose control. Additionally, the AID antibody can be used as a diagnostic tool for detecting autoantibodies against insulin in patients with autoimmune diseases such as type 1 diabetes. With its high specificity and affinity for insulin, the AID antibody offers promising potential in the field of Life Sciences and holds great promise for therapeutic applications.</p>

<p>HSFY1 antibody was raised in rabbit using the middle region of HSFY1 as the immunogen</p>

<p>Rabbit polyclonal SCLY antibody</p>

<p>DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS</p>

<p>Mouse monoclonal CD85j antibody (allophycocyanin)</p>

<p>Mouse monoclonal NPTN antibody</p>

<p>Rabbit polyclonal DBX1 antibody</p>

<p>Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN</p>

<p>Rabbit polyclonal PNMA1 antibody</p>

<p>TJP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS</p>

<p>The Cathepsin D antibody is a highly specialized nuclear antibody that acts as an inhibitor of cytotoxic growth factors. This monoclonal antibody specifically targets the epidermal growth factor and has been shown to effectively neutralize its effects. Additionally, the Cathepsin D antibody has been found to inhibit the activity of hepatocyte growth factor and family kinase inhibitors, making it an ideal therapeutic option for conditions such as thrombocytopenia. With its colloidal superoxide properties, this antibody offers a comprehensive approach to combating various diseases and promoting overall health. Polyclonal Antibodies have also been developed against tumor necrosis factor-alpha (TNF-α), further expanding the potential applications of this powerful immunological tool.</p>

<p>Purified recombinant ABHD12B protein (His tag)</p>

<p>Mouse monoclonal Toll-like receptor 3 antibody</p>

<p>GOT2 antibody was raised in Rabbit using Human GOT2 as the immunogen</p>

<p>Purified Rabbit polyclonal Cyclin B1 antibody (Ser147)</p>

<p>1-171 amino acids: MEQDNSPRKI QFTVPLLEPH LDPEAAEQIR RRRPTPATLV LTSDQSSPEI DEDRIPNPHL KSTLAMSPRQ RKKMTRITPT MKELQMMVEH HLGQQQQGEE PEGAAESTGT QESRPPGIPD TEVESRLGTS GTAKKTAECI PKTHERGSKE PSTKEPSTHI PPLDSKGANS VLEHHHHHH</p>

<p>KLHL32 antibody was raised in Rabbit using Human KLHL32 as the immunogen</p>

<p>BTK antibody was raised in Rabbit using Human BTK as the immunogen</p>

<p>Rabbit polyclonal ZNF98 antibody</p>

<p>Purified recombinant IGFLR1 protein (His tag)</p>

<p>MEGVHRKPSL LAHPGPLVKS EETVILQCWS DVRFQHFLLH REGKFKDTLH LIGEHHDGIS KANFSIGPMM QDLAGTYRCY GSVTHSPYQL SAPSDPLDIV ITGLYEKPSL SAQPGPTVLA GESVTLSCSS RSSYDMYHLS REGEAHERRF SAGPKVNGTF QADFPLGPAT HGGTYRCFGS FRDSPYEWSN SSDPLLVSVT GN</p>

<p>Mouse monoclonal RBM46 antibody</p>

<p>MYL6 antibody was raised using the middle region of MYL6 corresponding to a region with amino acids PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT</p>