Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.710 produits)
- Métabolites secondaires(14.222 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GALNT6 antibody
<p>GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP</p>TNF α antibody
<p>TNF alpha antibody was raised in Mouse using recombinant human TNF alpha as the immunogen.</p>B3GALNT2 antibody
<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMG</p>Degré de pureté :Min. 95%TST antibody
<p>TST antibody is a polypeptide expression of autoantibodies that specifically target the protein kinase. This antibody is widely used in Life Sciences research to study the role of protein kinases in various cellular processes. It has been shown to be effective in detecting and quantifying protein kinase activity in microvessel endothelial cells. TST antibody can also be used as a recombinant antigen for biochemical assays and interferon detection. Additionally, it has been utilized to investigate collagen-related diseases and evaluate the effects of inhibitors on protein kinase activity. With its versatility and specificity, TST antibody is an essential tool for researchers studying a wide range of biological processes, including non-alcoholic steatohepatitis and food extract analysis.</p>LDLRAD3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LDLRAD3 antibody, catalog no. 70R-9224</p>Degré de pureté :Min. 95%MAGEL2 antibody
<p>MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogen</p>Degré de pureté :Min. 95%nNOS antibody
<p>The nNOS antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody acts as an inhibitory factor against neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide in neurons. By specifically binding to nNOS, this antibody blocks its activity and prevents the production of nitric oxide.</p>CHST1 antibody
<p>CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV</p>Degré de pureté :Min. 95%HSP105 α protein (His tag)
<p>1-858 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMSVV GLDVGSQSCY IAVARAGGIE TIANEFSDRC TPSVISFGSK NRTIGVAAKN QQITHANNTV SNFKRFHGRA FNDPFIQKEK ENLSYDLVPL KNGGVGIKVM YMGEEHLFSV EQITAMLLTK LKETAENSLK KPVTDCVISV PSFFTDAERR SVLDAAQIVG LNCLRLMNDM TAVALNYGIY KQDLPSLDEK PRIVVFVDMG HSAFQVSACA FNKGKLKVLG TAFDPFLGGK NFDEKLVEHF CAEFKTKYKL DAKSKIRALL RLYQECEKLK KLMSSNSTDL PLNIECFMND KDVSGKMNRS QFEELCAELL QKIEVPLYSL LEQTHLKVED VSAVEIVGGA TRIPAVKERI AKFFGKDIST TLNADEAVAR GCALQCAILS PAFKVREFSV TDAVPFPISL IWNHDSEDTE GVHEVFSRNH AAPFSKVLTF LRRGPFELEA FYSDPQGVPY PEAKIGRFVV QNVSAQKDGE KSRVKVKVRV NTHGIFTIST ASMVEKVPTE ENEMSSEADM ECLNQRPPEN PDTDKNVQQD NSEAGTQPQV QTDAQQTSQS PPSPELTSEE NKIPDADKAN EKKVDQPPEA KKPKIKVVNV ELPIEANLVW QLGKDLLNMY IETEGKMIMQ DKLEKERNDA KNAVEEYVYE FRDKLCGPYE KFICEQDHQN FLRLLTETED WLYEEGEDQA KQAYVDKLEE LMKIGTPVKV RFQEAEERPK MFEELGQRLQ HYAKIAADFR NKDEKYNHID ESEMKKVEKS VNEVMEWMNN VMNAQAKKSL DQDPVVRAQE IKTKIKELNN TCEPVVTQPK PKIESPKLER TPNGPNIDKK EEDLEDKNNF GAEPPHQNGE CYPNEKNSVN MDLD</p>Degré de pureté :Min. 95%LYK5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYK5 antibody, catalog no. 70R-2049</p>Degré de pureté :Min. 95%OLR1 antibody
<p>OLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ</p>ZHX2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZHX2 antibody, catalog no. 20R-1178</p>Degré de pureté :Min. 95%Paxillin antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been extensively tested using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>GFAP antibody
<p>The GFAP antibody is a monoclonal antibody widely used in the field of Life Sciences. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important antigen involved in various cellular processes. This antibody has been extensively tested and proven to be highly effective in assays related to interferon, transferrin, anti-hbs, low-density lipoprotein, fatty acid metabolism, and other related research areas. With its high specificity and affinity, the GFAP antibody is a valuable tool for scientists and researchers studying the role of GFAP in different biological systems. It comes with all necessary excipients for optimal performance and is available in various formats to suit different experimental needs. Trust the GFAP antibody to provide reliable and accurate results for your research endeavors.</p>ZNF485 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF485 antibody, catalog no. 70R-8418</p>Degré de pureté :Min. 95%Fractalkine antibody
<p>The Fractalkine antibody is a powerful anticoagulant that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing the virus surface antigen, preventing its ability to cause harm. This antibody has been extensively studied and characterized using mass spectrometric methods, ensuring its high quality and effectiveness. In addition to its anticoagulant properties, the Fractalkine antibody also acts as a chemokine, attracting immune cells to the site of infection and promoting an effective immune response. It has been shown to activate 3-kinase signaling pathways and enhance interferon production. The Fractalkine antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. With its exceptional performance and reliability, this antibody is a valuable tool in Life Sciences research.</p>BNP antibody
<p>The BNP antibody is an acidic polyclonal antibody that targets the growth factor B-type natriuretic peptide (BNP). It is commonly used in Life Sciences research to study the role of BNP in various physiological processes. The BNP antibody specifically binds to BNP and inhibits its interaction with receptors, thereby modulating endothelial growth and insulin signaling pathways. This antibody can also be used for diagnostic purposes to measure BNP levels in patient samples. Additionally, the BNP antibody has been utilized as a therapeutic agent in targeted cancer therapies, particularly in combination with anti-HER2 antibodies like trastuzumab. With its high specificity and affinity for BNP, this monoclonal antibody offers researchers and clinicians a valuable tool for studying and manipulating the natriuretic peptide system.</p>17b Testosterone-HRP
<p>17b-Testosterone 3 Conjugate for use in immunoassays</p>Degré de pureté :Min. 95%ADK protein (His tag)
<p>22-362 amino acids: MGSSHHHHHH SSGLVPRGSH MRENILFGMG NPLLDISAVV DKDFLDKYSL KPNDQILAED KHKELFDELV KKFKVEYHAG GSTQNSIKVA QWMIQQPHKA ATFFGCIGID KFGEILKRKA AEAHVDAHYY EQNEQPTGTC AACITGDNRS LIANLAAANC YKKEKHLDLE KNWMLVEKAR VCYIAGFFLT VSPESVLKVA HHASENNRIF TLNLSAPFIS QFYKESLMKV MPYVDILFGN ETEAATFARE QGFETKDIKE IAKKTQALPK MNSKRQRIVI FTQGRDDTIM ATESEVTAFA VLDQDQKEII DTNGAGDAFV GGFLSQLVSD KPLTECIRAG HYAASIIIRR TGCTFPEKPD FH</p>Degré de pureté :Min. 95%ApoC-III protein
<p>ApoC-III protein is a glycoprotein that plays a crucial role in lipid metabolism and cardiovascular health. It is involved in the regulation of triglyceride levels by inhibiting lipoprotein lipase, an enzyme responsible for breaking down triglycerides. ApoC-III also interacts with various proteins and molecules, including fibrinogen, collagen, and tyrosine, contributing to its multifunctional nature. This protein has garnered significant interest in the medical and scientific communities due to its potential implications in cardiovascular diseases and metabolic disorders. Researchers have developed autoantibodies and monoclonal antibodies targeting ApoC-III as potential therapeutic agents for managing hypertriglyceridemia and related conditions. Furthermore, studies have shown that ApoC-III exhibits anticoagulant properties by interfering with the activation of blood clotting factors. This characteristic makes it a valuable component in colloidal solutions used for preventing clot formation during medical procedures. In addition to its role in lipid metabolism</p>Degré de pureté :>98% By Sds-PageHemoglobin Powder (bovine)
<p>Please enquire for more information about Hemoglobin Powder (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%ZNF682 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF682 antibody, catalog no. 70R-8400</p>Degré de pureté :Min. 95%BTBD15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTBD15 antibody, catalog no. 70R-8088</p>Degré de pureté :Min. 95%RPS21 antibody
<p>RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF</p>ERH antibody
<p>The ERH antibody is a monoclonal antibody that targets the ERH protein. This protein is involved in various cellular processes, including insulin signaling and glutamate metabolism. The ERH antibody specifically recognizes the amino group of the ERH protein and can be used in various applications, such as Western blotting and immunohistochemistry.</p>PLEKHB2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHB2 antibody, catalog no. 70R-4316</p>Degré de pureté :Min. 95%GPX2 antibody
<p>GPX2 antibody was raised in rabbit using the middle region of GPX2 as the immunogen</p>Degré de pureté :Min. 95%UNC5A antibody
<p>UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT</p>Degré de pureté :Min. 95%ZNF335 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF335 antibody, catalog no. 70R-8365</p>Degré de pureté :Min. 95%ZNF546 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF546 antibody, catalog no. 70R-8163</p>Degré de pureté :Min. 95%IGSF1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6035</p>Degré de pureté :Min. 95%CD49d antibody (Azide Free)
<p>CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>HNRNPC antibody
<p>HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN</p>SHMT2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SHMT2 antibody, catalog no. 70R-1287</p>Degré de pureté :Min. 95%KCNJ1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNJ1 antibody, catalog no. 70R-5144</p>Degré de pureté :Min. 95%Caspase 3 antibody
<p>The Caspase 3 antibody is a highly effective and cytotoxic medicament used in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, is specifically designed to target and neutralize activated caspase 3 proteins. By binding to these proteins, the Caspase 3 antibody effectively inhibits their activity, preventing cell death and promoting cell survival.</p>Degré de pureté :Min. 95%SPZ1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPZ1 antibody, catalog no. 20R-1158</p>Degré de pureté :Min. 95%NGAL antibody
<p>The NGAL antibody is a highly specialized monoclonal antibody that has been extensively studied in the field of Life Sciences. It is an 8-substituted antibody that exhibits glycosylation, making it highly effective in targeting specific molecules and proteins within the body. The NGAL antibody has shown promising results in inhibiting interleukin-6, a key growth factor involved in various inflammatory processes. Additionally, this antibody has demonstrated its efficacy in neutralizing antibodies such as erythropoietin and epidermal growth factor, which play crucial roles in certain diseases. The NGAL antibody's unique structure allows it to bind specifically to tyrosine residues on target molecules, enabling precise targeting and modulation of cellular functions. Its binding affinity has been proven through rigorous laboratory testing using state-of-the-art electrode techniques. In recent studies, the NGAL antibody has shown potential therapeutic effects against Helicobacter pylori infection, a bacteria known for causing gastric ulcers and other gastrointestinal disorders. Furthermore, this</p>L 006235
CAS :<p>L 006235 is a lipophilic localizing agent that can be used as a marker protein. It binds to the extracellular matrix and is localized in the dermis, epidermis, and corneal stroma. L 006235 has been shown to inhibit protease activity and is effective in reducing autoimmune diseases such as rheumatoid arthritis. L 006235 also inhibits the formation of osteoclasts, which are cells that break down bone tissue. This drug has been shown to have potent antagonist effects on collagen type I receptor sites in vitro. L 006235 is used for preventing or treating inflammatory conditions such as psoriasis and psoriatic arthritis.</p>Formule :C24H30N6O2SDegré de pureté :Min. 95%Masse moléculaire :466.6 g/molNOB1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOB1 antibody, catalog no. 70R-3402</p>Degré de pureté :Min. 95%CDKL5 antibody
<p>The CDKL5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CDKL5 protein, which plays a crucial role in various cellular processes. The antibody works by binding to the CDKL5 protein and inhibiting its activity, allowing researchers to study its function and potential therapeutic applications.</p>SIGLEC10 antibody
<p>SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL</p>Degré de pureté :Min. 95%β Catenin antibody
<p>The beta Catenin antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and detects activated nuclear β-catenin, a critical protein involved in various cellular processes. This antibody has been extensively validated for its high specificity and sensitivity.</p>Influenza A H3N2 protein (Panama)
<p>Purified native Influenza A H3N2 protein (Panama)</p>Degré de pureté :Min. 95%α 2 Antiplasmin antibody
<p>alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.</p>Degré de pureté :Min. 95%TIMP2 antibody
<p>The TIMP2 antibody is a monoclonal antibody that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets adipose tissue and has been found to have potential therapeutic effects in diseases related to adiponectin, such as obesity and diabetes.</p>RELM α protein
<p>Region of RELM alpha protein corresponding to amino acids MDETIEIIVE NKVKELLANP ANYPSTVTKT LSCTSVKTMN RWASCPAGMT ATGCACGFAC GSWEIQSGDT CNCLCLLVDW TTARCCQLS.</p>Degré de pureté :Min. 95%Leptin Receptor antibody
<p>The Leptin Receptor antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the leptin receptor in human serum. Leptin receptor plays a crucial role in regulating various physiological processes such as metabolism, appetite, and energy balance. This antibody specifically binds to the leptin receptor and inhibits its activity, thereby modulating the signaling pathways associated with it.</p>CYP2A7 antibody
<p>CYP2A7 antibody was raised using the middle region of CYP2A7 corresponding to a region with amino acids KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI</p>Degré de pureté :Min. 95%Donkey anti Rabbit IgG (H + L) (rhodamine)
<p>Donkey anti-rabbit IgG (H+L) (Rhodamine) was raised in donkey using rabbit IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%PSMA4 antibody
<p>PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN</p>ZNF676 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF676 antibody, catalog no. 70R-8867</p>Degré de pureté :Min. 95%Bub1 Antibody
<p>The Bub1 Antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and neutralize the protein kinase activity of Bub1, a key regulator of the cell cycle. This antibody has been shown to inhibit the phosphorylation of downstream targets, such as p38 MAPK, and interfere with cell growth and proliferation. Additionally, it has been demonstrated to block the activation of phosphatases and reduce the levels of interleukin-6, an important pro-inflammatory cytokine. With its high specificity and potency, the Bub1 Antibody is an essential tool for studying cell signaling pathways and understanding their role in various biological processes.</p>PHF19 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF19 antibody, catalog no. 70R-8879</p>Degré de pureté :Min. 95%PHYH antibody
<p>PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI</p>Degré de pureté :Min. 95%ADAM12 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM12 antibody, catalog no. 70R-6059</p>Degré de pureté :Min. 95%COL3A1 antibody
<p>The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3</p>PSMB5 antibody
<p>PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ</p>SOX4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX4 antibody, catalog no. 70R-8248</p>Degré de pureté :Min. 95%CDC42 antibody
<p>The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.</p>FILIP1L antibody
<p>FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY</p>ABCA1 antibody
<p>The ABCA1 antibody is a neuroprotective monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and medical applications to study the function and regulation of ABCA1, a key protein involved in lipid metabolism and cholesterol efflux. This antibody specifically targets ABCA1 and inhibits its proteolytic activity, preventing the degradation of this important protein.</p>
