Produits biochimiques et réactifs

<p>Rabbit polyclonal CCDC45 antibody</p>

<p>The CCL2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects delta-9-tetrahydrocannabinol (THC), a key compound found in cannabis. This antibody has been extensively tested and validated for its accuracy and sensitivity in detecting THC in various samples, including human serum.</p>

<p>LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Purified recombinant IGLL1 protein (His tag)</p>

<p>Rabbit polyclonal CDPK13 antibody</p>

<p>The Androgen Receptor antibody is a powerful tool used in Life Sciences research. It is available as both Polyclonal Antibodies and Monoclonal Antibodies, providing researchers with options to suit their specific needs. This antibody targets the Androgen Receptor, a protein that plays a crucial role in steroid signaling and growth factor regulation.</p>

<p>Rabbit polyclonal SLC38A1 antibody</p>

<p>DGKH antibody was raised in Rabbit using Human DGKH as the immunogen</p>

<p>Purified recombinant Human PHPT1 protein</p>

<p>ZNF93 antibody was raised in rabbit using the N terminal of ZNF93 as the immunogen</p>

<p>Affinity purified Sheep polyclonal Sheep anti Bovine IgG1 antibody</p>

<p>IRF7 antibody was raised in mouse using recombinant human IRF-7 (1-150aa) purified from E. coli as the immunogen.</p>

<p>CD5l protein is a pluripotent stem cell-derived protein that plays a crucial role in various biological processes. It has been shown to have therapeutic potential in the treatment of choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. CD5l protein can neutralize the activity of certain growth factors involved in this process, thereby inhibiting the formation of new blood vessels.</p>

<p>Rat monoclonal IL4 antibody (PE)</p>

<p>Purified Polyclonal GAD1 antibody</p>

<p>Rabbit polyclonal OR10G9 antibody</p>

<p>The ERCC1 antibody is a polyclonal antibody that has been developed for use in life sciences research. It is used to detect and measure the expression of ERCC1, a protein involved in DNA repair and maintenance. This antibody has been shown to have inhibitory properties against neurotrophic factors, TGF-β1, insulin, and chemokines. It can also neutralize the activity of interferons and other activated proteins. The ERCC1 antibody is commonly used in immunoassays and can be used to study various cellular processes such as collagen synthesis, protein kinase activity, and the effects of nuclear inhibitors.</p>

<p>Purified Polyclonal GLRB antibody</p>

<p>Purified recombinant Human HRSP12 protein</p>

<p>MYST2 antibody was raised in Rabbit using Human MYST2 as the immunogen</p>

<p>Purified recombinant Human RALB protein</p>

<p>Rabbit polyclonal CD44 antibody (Ser706)</p>

<p>Rabbit polyclonal DUS4 antibody</p>

<p>Mouse monoclonal PIH1D2 antibody</p>

<p>Rabbit polyclonal GPR63 antibody</p>

<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF652 antibody, catalog no. 70R-7878</p>

<p>CDK6 antibody was raised in Rabbit using Human CDK6 as the immunogen</p>

<p>Transportin 1/MIP Monoclonal Antibody BSA/Azide Free</p>

<p>AAMP antibody was raised in Rabbit using Human AAMP as the immunogen</p>

<p>The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.</p>

<p>Rabbit polyclonal AMOTL1 antibody</p>

<p>HSV1 gD antibody was raised in mouse using herpes simplex I and II-infected cells as the immunogen.</p>

<p>Redd1 is a transcriptional regulator that functions as a negative regulator of inflammation. Redd1 induces the expression of IL-12 in human monocytes, which can lead to the suppression of inflammatory responses. Redd1 also inhibits the development of regulatory T cells and Th17 cells, which are important for maintaining immune tolerance. Redd1 is induced by microbial products and the pathogen Toxoplasma gondii, but it is overridden by IL-12 in the presence of this cytokine. The induction of Redd1 is mediated by IL-12 through activation of STAT3 transcription factor.<br>!--END--&gt;</p>

<p>CHRNA3 antibody was raised in rabbit using the N terminal of CHRNA3 as the immunogen</p>

<p>Mouse monoclonal MAPK7 antibody</p>

<p>Rabbit polyclonal IKBB antibody (Ser23)</p>

<p>CD3 antibody was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>Purified recombinant Treponema pallidum protein</p>

<p>Purified Polyclonal 14 3 3 theta antibody</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Purified Polyclonal ACOT8 antibody</p>

<p>POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP</p>

<p>LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC</p>

<p>Purified recombinant GNAZ protein (His tag)</p>

<p>Rabbit polyclonal PPP1R14A antibody</p>

<p>The Tyrosine Hydroxylase antibody is a specific antibody used in Life Sciences research. It is commonly used to study the cholinergic and dopamine systems in the brain. This antibody targets tyrosine hydroxylase, which is an enzyme involved in the synthesis of dopamine. By detecting and measuring levels of tyrosine hydroxylase, researchers can gain valuable insights into neurological disorders such as Parkinson's disease and schizophrenia.</p>

<p>PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS</p>

<p>Purified recombinant RPL11 protein (His tag)</p>

<p>9-OH Risperidone chemical reference substance</p>

<p>Mouse monoclonal IkBa antibody (N-terminus)</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Eif4e antibody, catalog no. 70R-9620</p>

<p>CCND3 antibody was raised in Rabbit using Human CCND3 as the immunogen</p>

<p>Purified recombinant LYG2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRRC1 antibody, catalog no. 70R-3262</p>

<p>GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen</p>

<p>The NUMB antibody is a monoclonal antibody derived from streptomyces. It has hypomethylating properties and is used in the field of life sciences for various applications. This antibody specifically targets and binds to NUMB, a protein involved in cell differentiation and development. The NUMB antibody has chemotherapeutic potential and has been studied for its ability to inhibit the growth of cancer cells. It can also be used in research settings for chromatographic and immunohistochemical studies. With its unique properties and specificity, the NUMB antibody offers promising avenues for further exploration in the field of molecular biology and therapeutics.</p>

<p>Rabbit polyclonal CCL2 antibody (biotin)</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>The SIRT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the SIRT1 protein, which is involved in various cellular processes such as epidermal growth factor signaling and histone deacetylation. This monoclonal antibody offers high specificity and sensitivity, making it an ideal tool for researchers studying the role of SIRT1 in different biological pathways.</p>

<p>CRSP2 antibody was raised in mouse using recombinant Human Cofactor Required For Sp1 Transcriptional Activation, Subunit 2, 150Kda (Crsp2)</p>

<p>GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG</p>

<p>ATP2A2 antibody was raised using the C terminal of ATP2A2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV</p>

<p>GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM</p>

<p>The NUP62 antibody is a polyclonal antibody that specifically binds to NUP62, a protein involved in various cellular processes. This antibody can be used in life sciences research to study the role of NUP62 in different biological pathways. It has been shown to interact with other binding proteins and lipoprotein lipase, suggesting its involvement in lipid metabolism. Additionally, the NUP62 antibody has the ability to bind to cations and growth factors, indicating its potential role in signal transduction pathways. This antibody can also be used for the detection of autoantibodies in reactive conditions or as a diagnostic tool for diseases such as cancer. The NUP62 antibody is produced using advanced techniques and high-quality materials, ensuring reliable and reproducible results.</p>

<p>DR1 antibody was raised in Rabbit using Human DR1 as the immunogen</p>

<p>C19ORF54 antibody was raised using the N terminal Of C19Orf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT</p>

<p>MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF133 antibody, catalog no. 70R-7337</p>

<p>PEX11A antibody was raised using the middle region of PEX11A corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL</p>

<p>CD28 antibody was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>Purified native Mouse Troponin I protein (Cardiac)</p>

<p>Rabbit Polyclonal IRS1 antibody (Ser612)</p>

<p>Fenquinotrione is an anticancer drug that belongs to the class of inhibitors known as protein kinase inhibitors. It is a Chinese medicinal analog that has been shown to inhibit tumor growth by inducing apoptosis in cancer cells. Fenquinotrione acts as an inhibitor of kinases, which are enzymes involved in cell signaling and regulation. This drug has been found to be effective against various types of cancer, including lung, breast, and colon cancer. Fenquinotrione inhibits the activity of certain kinases involved in cancer cell proliferation and survival. It also blocks the formation of new blood vessels that supply nutrients to tumors, thereby preventing their growth. Fenquinotrione is excreted primarily through urine and has a favorable safety profile with minimal side effects.</p>

<p>LOC344065 antibody was raised in rabbit using the N terminal of LOC344065 as the immunogen</p>

<p>ATG5 antibody was raised in rabbit using the middle region of ATG5 as the immunogen</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Purified Polyclonal Integrin beta 5 antibody</p>

<p>Rabbit polyclonal HOXD12 antibody</p>

<p>1-189 amino acids: MGSSHHHHHH SSGLVPRGSH MQAIKCVVVG DGAVGKTCLL ISYTTNAFPG EYIPTVFDNY SANVMVDSKP VNLGLWDTAG QEDYDRLRPL SYPQTDVFLI CFSLVSPASY ENVRAKWFPE VRHHCPSTPI ILVGTKLDLR DDKDTIEKLK EKKLAPITYP QGLALAKEID SVKYLECSAL TQRGLKTVFD EAIRAVLCPQ PTRQQKRAC</p>

<p>The eIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (eIF4E). This protein plays a crucial role in the regulation of gene expression and protein synthesis. The eIF4E antibody has been extensively studied for its ability to inhibit the activity of eIF4E, thereby disrupting the translation of specific mRNA molecules.</p>

<p>Rabbit polyclonal FOXB1/2 antibody</p>

<p>The PRL antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to prolactin (PRL), a hormone involved in various physiological processes such as lactation, reproduction, and metabolism. This antibody is widely used in studies related to steroid hormones, dopamine, globulin, and progesterone. It can be utilized for applications such as immunohistochemistry, Western blotting, ELISA assays, and flow cytometry.</p>

<p>CD61 antibody was raised in mouse using human CD61 as the immunogen.</p>

<p>Rat monoclonal OCT3/4 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC2 antibody, catalog no. 70R-7035</p>

<p>Rabbit polyclonal USP46 antibody</p>

<p>Inhibits chaperone protein Hsp90; antineoplastic</p>

<p>The TXNDC5 antibody is a highly specific antibody that targets the antigen transthyretin. It is available in both polyclonal and monoclonal forms. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of transthyretin levels in biological samples. The TXNDC5 antibody has been shown to be activated by interleukin-6 and natriuretic peptides, making it an important tool for studying their signaling pathways. Additionally, this antibody has been used to investigate the role of TXNDC5 in antiestrogen resistance and nuclear processes. With its high specificity and sensitivity, the TXNDC5 antibody is a valuable tool for researchers working with nuclear extracts and studying the viscosity of biological samples. Choose this antibody for reliable results and accurate analysis in your experiments.</p>

<p>IGBP1 antibody was raised in Rabbit using Human IGBP1 as the immunogen</p>

<p>UGT2B15 antibody was raised using the N terminal of UGT2B15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC8 antibody, catalog no. 70R-6686</p>

<p>Recombinant Human CSK protein</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>CDYL antibody was raised in Rabbit using Human CDYL as the immunogen</p>