Produits biochimiques et réactifs

<p>Diclazuril chemical reference substance</p>

<p>OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA</p>

<p>The SERPINA3 antibody is a monoclonal antibody that targets the SERPINA3 protein. This protein plays a crucial role in various biological processes, including the regulation of lipoprotein metabolism and mineralocorticoid receptor activity. The antibody specifically binds to the SERPINA3 protein, forming a protein complex that inhibits its function.</p>

<p>PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The FOXB2 antibody is a highly specialized antibody that targets specific proteins and markers in various biological processes. This antibody specifically binds to osteopontin, E-cadherin, amyloid plaque, oncostatin, glutamate, serum albumin protein, and β-catenin. It is widely used in the field of life sciences for research purposes.</p>

<p>The SRY antibody is a biomolecule that specifically targets the sex-determining region Y (SRY) protein. It is commonly used in research involving mesenchymal stem cells and brain natriuretic peptide. This antibody is buffered to ensure stability and effectiveness in various experimental conditions. The SRY antibody is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with different options depending on their specific needs. It can be used as a standalone reagent or as part of a conjugate compound for enhanced detection and analysis. With its cytotoxic and growth factor properties, the SRY antibody plays a crucial role in various life sciences applications.</p>

<p>HCFC2 antibody was raised in mouse using recombinant Human Host Cell Factor C2</p>

<p>Purified recombinant UNG protein (His tag)</p>

<p>SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW</p>

<p>Abcf1 antibody was raised in rabbit using the C terminal of Abcf1 as the immunogen</p>

<p>ZBTB32 antibody was raised in rabbit using the N terminal of ZBTB32 as the immunogen</p>

<p>Rabbit polyclonal RB antibody (Thr821)</p>

<p>Recombinant Human AKT1 protein (His tag)</p>

<p>HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The RB antibody is a highly specialized monoclonal antibody that has been developed for ultrasensitive detection in the field of Life Sciences. This antibody exhibits high affinity and specificity towards its target molecule, making it ideal for immunoassays and other research applications.</p>

<p>Mouse monoclonal NPTN antibody</p>

<p>ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA</p>

<p>NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT</p>

<p>ALDH3A1 antibody was raised in rabbit using the N terminal of ALDH3A1 as the immunogen</p>

<p>The E2F1 antibody is a highly specific monoclonal antibody that targets the E2F1 protein. This protein plays a crucial role in regulating cell growth and division, making it an important target for research in the field of Life Sciences.</p>

<p>The CD144 antibody is a neutralizing monoclonal antibody that specifically targets the CD144 antigen. It is commonly used in Life Sciences research to study various cellular processes and signaling pathways. The CD144 antibody can effectively block the activity of CD144, which is a low-density lipoprotein receptor-related protein involved in cell adhesion and growth factor signaling. This antibody has been shown to inhibit the binding of growth factors such as epidermal growth factor (EGF) and interferon-gamma (IFN-gamma) to their respective receptors, thereby modulating cellular responses. The CD144 antibody is highly specific and does not cross-react with other antibodies or antigens. It can be used in various experimental techniques, including immunofluorescence, immunohistochemistry, and Western blotting, to investigate the role of CD144 in different biological systems. With its high affinity and excellent performance, the CD144 antibody is an essential tool for researchers studying cell biology and molecular mechanisms.</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>

<p>13-314 amino acids: MGSSHHHHHH SSGLVPRGSH MSSSSTASAS AKKIIVKHVT VIGGGLMGAG IAQVAAATGH TVVLVDQTED ILAKSKKGIE ESLRKVAKKK FAENPKAGDE FVEKTLSTIA TSTDAASVVH STDLVVEAIV ENLKVKNELF KRLDKFAAEH TIFASNTSSL QITSIANATT RQDRFAGLHF FNPVPVMKLV EVIKTPMTSQ KTFESLVDFS KALGKHPVSC KDTPGFIVNR LLVPYLMEAI RLYERGDASK EDIDTAMKLG AGYPMGPFEL LDYVGLDTTK FIVDGWHEMD AENPLHQPSP SLNKLVAENK FGKKTGEGFY KYK</p>

<p>DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL</p>

<p>Please enquire for more information about Tetraethyleneglycol bisibuprofen ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ADORA2B antibody was raised in rabbit using the C terminal of ADORA2B as the immunogen</p>

<p>CLCC1 antibody was raised in rabbit using the N terminal of CLCC1 as the immunogen</p>

<p>Purified Rabbit polyclonal TOP2A antibody (Ser1106)</p>

<p>HBsAg is the surface antigen of the Hepatitis-B-Virus (HBV). The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen. HBsAg is an important parameter to establish a diagnosis of hepatitis B disease in the clinic and to monitor antiviral treatment.</p>

<p>Goat anti-feline IgG (H + L) (biotin) was raised in goat using feline IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal NKX31 antibody</p>

<p>Stabilization buffer for use in Poly-HRP enhanced enzymatic labelling of antibodies and antigens</p>

<p>LAG3 antibody was raised in Rabbit using Human LAG3 as the immunogen</p>

<p>TRAF6 antibody was raised in rabbit using the middle region of TRAF6 as the immunogen</p>

<p>Rabbit polyclonal TXN2 antibody</p>

<p>Mouse monoclonal VSIG2 antibody</p>

<p>Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.</p>

<p>Purified Rabbit polyclonal CNTN6 antibody</p>

<p>Rabbit polyclonal HSL antibody (Ser855/554)</p>

<p>Rabbit polyclonal HNRCL antibody</p>

<p>Rabbit polyclonal UBP1 antibody</p>

<p>Purified Polyclonal ELOF1 antibody</p>

<p>The PTGER2 antibody is an inhibitor that specifically targets the PTGER2 protein, which is involved in various cellular processes. It is commonly used as a research tool to study the function and regulation of PTGER2. This antibody has been shown to be effective in blocking the activity of PTGER2 in various assays, including chloride secretion assays and interferon-stimulated gene expression assays. Additionally, it has been used to detect the presence of PTGER2 in serum samples, making it a valuable serum marker for certain diseases. The PTGER2 antibody is a polyclonal antibody that has been extensively tested and validated for its specificity and sensitivity. Its high-flux binding capacity ensures accurate and reliable results in experimental settings. Whether you are conducting research or developing new therapeutic strategies, the PTGER2 antibody is an essential tool for studying PTGER2-related pathways and mechanisms.</p>

<p>1-131 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMCF PKVLSDDMKK LKARMHQAIE RFYDKMQNAE SGRGQVMSSL AELEDDFKEG YLETVAAYYE EQHPELTPLL EKERDGLRCR GNRSPVPDVE DPATEEPGES FCDKSYGAPR GDKEELTPQK CSEPQSSK</p>

<p>The CTLA4 antibody is a glycoprotein that acts as a kinase inhibitor. It belongs to the class of monoclonal antibodies and is commonly used in the treatment of various diseases, including cancer and autoimmune disorders. This antibody specifically targets CD20, a protein expressed on the surface of certain cells, including B lymphocytes. By binding to CD20, the CTLA4 antibody activates immune responses against these cells, leading to their destruction.</p>

<p>MORF4L2 antibody was raised in Rabbit using Human MORF4L2 as the immunogen</p>

<p>EB2 antibody was raised in Rat using Mouse EB2 fused to GST as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB4 antibody, catalog no. 70R-4586</p>

<p>C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL</p>

<p>Mouse monoclonal UBL4A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI3 antibody, catalog no. 70R-9627</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Sheep polyclonal Tramadol N antibody</p>

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

<p>ZNF415 antibody was raised in rabbit using the N terminal of ZNF415 as the immunogen</p>

<p>DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV</p>

<p>The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.</p>

<p>Purified recombinant GOLGA7 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPT4 antibody, catalog no. 70R-5269</p>

<p>ADRA2C antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human Alpha 2c protein as the immunogen.</p>

<p>Purified Polyclonal CRABP2 antibody</p>

<p>Rabbit polyclonal USP32 antibody</p>

<p>Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal TAF9 antibody</p>

<p>Purified recombinant Mouse LGALS3 protein</p>

<p>Purified recombinant IFNL2 protein (His tag)</p>

<p>C1ORF75 antibody was raised using the N terminal Of C1Orf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP</p>

<p>Rabbit polyclonal VAMP5 antibody</p>

<p>The ACSS2 antibody is a powerful tool in the field of life sciences. It specifically targets and detects TGF-beta, alpha-fetoprotein, and phosphatase-activated adenosine triphosphate. This monoclonal antibody is widely used for immunohistochemical detection in various research applications.</p>

<p>LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL</p>

<p>Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>

<p>The Chk2 antibody is a potent inhibitor of the catechol-O-methyltransferase (COMT) family kinase. It has been shown to induce necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated cell death in cancer cells. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of Plasmodium falciparum, the parasite that causes malaria. The Chk2 antibody is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers studying various biological processes. Its cytotoxic properties make it an ideal candidate for targeted therapies against cancer, while its nuclear localization allows for efficient detection and analysis in immunofluorescence experiments.</p>

<p>Purified recombinant GULP1 protein (His tag)</p>

<p>Purified Polyclonal Cytochrome P450 2A7 antibody</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody (HRP)</p>

<p>FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK</p>

<p>HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW</p>

<p>ZNF385 antibody was raised in rabbit using the N terminal of ZNF385 as the immunogen</p>

<p>FCRL4 antibody was raised using the N terminal of FCRL4 corresponding to a region with amino acids FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR</p>

<p>The STRAP antibody is a highly specialized monoclonal antibody that targets human serum albumin. It contains an EGF-like domain, which allows it to bind specifically to epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for various applications, including immunoassays and molecular docking studies.</p>

<p>Rabbit polyclonal TSC22D1 antibody</p>

<p>MRPL12 antibody was raised in Rabbit using Human MRPL12 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf10 antibody, catalog no. 70R-5858</p>

<p>Rabbit polyclonal PEK antibody</p>

<p>61-184 amino acids: MASMTGGQQM GRGSMSSSED KITVHFINRD GETLTTKGKV GDSLLDVVVE NNLDIDGFGA CEGTLACSTC HLIFEDHIYE KLDAITDEEN DMLDLAYGLT DRSRLGCQIC LTKSMDNMTV RVPETVADAR QSIDVGKTS</p>

<p>Goat anti Mouse IgG2a secondary antibody (FITC)</p>

<p>Purified Polyclonal HOXD12 antibody</p>

<p>Alkaline Phosphatase (ALP, Orthophosphoric-Monoester Phosphohydrolase, systematic name phosphate-monoester phosphohydrolase (alkaline optimum), EC 3.1.3.1, CAS Number [9001-78-9]) is an enzyme that catalyzes the following reaction:  a phosphate monoester + H2O → an alcohol + phosphate  One unit catalyzes of the Alkaline Phosphatase will hydrolyze 1.0 μmol of p-nitrophenyl phosphate per minute at pH 10.35 and 37°C in the presence of 2-amino-2-methyl-1-propanol. Porcine kidney alkaline phosphatase comes in lyophilized form, lyophilized from tris chloride with magnesium chloride and zinc chloride, pH 8.0. Appearance is tan powder. Activity is ≥50U/mg, specific activity ≥50 U/mg protein. It is soluble in saline giving a clear colorless to tan solution at 1mg/mL. Store at -20°C on arrival.</p>

<p>Mouse monoclonal RABL2A antibody</p>

<p>Rabbit polyclonal RNH1 antibody</p>

<p>EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI</p>

<p>Rabbit polyclonal IL4 antibody (HRP)</p>

<p>Purified Rabbit polyclonal cRaf antibody (Ser296)</p>