Produits biochimiques et réactifs

<p>4-[(6-Chloro-2-methoxy-9-acridinyl)amino]-2-[(4-methyl-1-piperazinyl)methyl]phenol trihydrochloride is an inhibitor of receptor, ligand, and activator. It is a high purity product that is used in life science, pharmacology, and cell biology research. It is also used as a research tool for studying ion channels and peptides. This compound can be used to study protein interactions with antibodies and other proteins.</p>

<p>Purified Polyclonal GYS1 antibody</p>

<p>Rabbit Polyclonal TMEM200A antibody</p>

<p>Purified Rabbit polyclonal OR13G1 antibody</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>

<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>Rabbit polyclonal OR6S1 antibody</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Tyr204)</p>

<p>Rabbit polyclonal COX41 antibody</p>

<p>1-646 amino acids: MGSSHHHHHH SSGLVPRGSH MSKGPAVGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL IGDAAKNQVA MNPTNTVFDA KRLIGRRFDD AVVQSDMKHW PFMVVNDAGR PKVQVEYKGE TKSFYPEEVS SMVLTKMKEI AEAYLGKTVT NAVVTVPAYF NDSQRQATKD AGTIAGLNVL RIINEPTAAA IAYGLDKKVG AERNVLIFDL GGGTFDVSIL TIEDGIFEVK STAGDTHLGG EDFDNRMVNH FIAEFKRKHK KDISENKRAV RRLRTACERA KRTLSSSTQA SIEIDSLYEG IDFYTSITRA RFEELNADLF RGTLDPVEKA LRDAKLDKSQ IHDIVLVGGS TRIPKIQKLL QDFFNGKELN KSINPDEAVA YGAAVQAAIL SGDKSENVQD LLLLDVTPLS LGIETAGGVM TVLIKRNTTI PTKQTQTFTT YSDNQPGVLI QVYEGERAMT KDNNLLGKFE LTGIPPAPRG VPQIEVTFDI DANGILNVSA VDKSTGKENK ITITNDKGRL SKEDIERMVQ EAEKYKAEDE KQRDKVSSKN SLESYAFNMK ATVEDEKLQG KINDEDKQKI LDKCNEIINW LDKNQTAEKE EFEHQQKELE KVCNPIITKL YQSAGGMPGG MPGGFPGGGA PPSGGASSGP TIEEVD</p>

<p>Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.</p>

<p>Ccna2 antibody was raised in rabbit using the C terminal of Ccna2 as the immunogen</p>

<p>MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids  RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM</p>

<p>ANXA3 antibody is a monoclonal antibody that targets mesothelin, a growth factor that is overexpressed in various types of cancer. This antibody specifically binds to mesothelin and neutralizes its activity, inhibiting tumor growth and metastasis. ANXA3 antibody has been shown to have high specificity and affinity for mesothelin, making it an effective tool for diagnostic assays and potential therapeutic applications. Additionally, this antibody can be used in research studies to investigate the role of mesothelin in cancer development and progression. Overall, ANXA3 antibody offers promise as a valuable tool in the fight against cancer.</p>

<p>Mouse monoclonal Cytokeratin 13 antibody</p>

<p>IQWD1 antibody was raised in Rabbit using Human IQWD1 as the immunogen</p>

<p>BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD</p>

<p>EIF4G3 antibody was raised using the middle region of EIF4G3 corresponding to a region with amino acids MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES</p>

<p>Rabbit polyclonal PSMC6 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>The Giardia lamblia antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to Giardia lamblia, a common parasite that causes gastrointestinal infections in humans. This antibody works by recognizing and binding to specific proteins on the surface of Giardia lamblia, effectively neutralizing its activity and preventing further infection.</p>

<p>Purified recombinant TRAPPC2 protein</p>

<p>Rabbit polyclonal TSR2 antibody</p>

<p>FBXL4 antibody was raised in mouse using recombinant Human F-Box And Leucine-Rich Repeat Protein 4 (Fbxl4)</p>

<p>Rabbit polyclonal SMAP1 antibody</p>

<p>Rabbit polyclonal RPS27L antibody</p>

<p>N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a peptide that acts as an activator of ion channels and a ligand for receptors. It also has the ability to inhibit protein interactions. N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a research tool for cell biology and pharmacology studies. This peptide is used in the study of ion channels and their role in cell signaling. It can be used to study receptor binding or protein interactions with ligands.</p>

<p>GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF</p>

<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>

<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>

<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Purified recombinant GNRH1 protein (His tag)</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant CSF2RA protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, the active form of this drug is metabolized. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV</p>

<p>HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Rat monoclonal CD44 antibody (FITC)</p>

<p>The NUMB antibody is a powerful tool in the field of life sciences. It belongs to the class of monoclonal antibodies and is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α). This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>MAP3K4 antibody was raised in Rabbit using Human MAP3K4 as the immunogen</p>

<p>LSR antibody was raised in Rabbit using Human LSR as the immunogen</p>

<p>Purified recombinant H3F3A protein (His tag)</p>

<p>Mouse monoclonal ARL5B antibody</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM2 antibody, catalog no. 70R-2848</p>

<p>NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD</p>

<p>Rabbit polyclonal SNAI1 antibody (Ser246)</p>

<p>Rabbit polyclonal NDM1 antibody (biotin)</p>

<p>Sheep polyclonal Despropionyl Fentanyl antibody</p>

<p>The BSG antibody is a highly potent and specialized cytotoxic monoclonal antibody that has neutralizing properties. It is commonly used in immunoassays and other life science applications. This antibody specifically targets the glycoprotein known as BSG, which plays a crucial role in various cellular processes.</p>

<p>The p90RSK antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets actin, a protein involved in various cellular processes. The antibody has been proven effective in detecting activated p90RSK in human serum samples. This antibody is also utilized as a tool to study multidrug resistance and the development of pegylated inhibitors. Additionally, it has shown promising results in the detection of alpha-fetoprotein, an important biomarker for certain cancers. The p90RSK antibody can be used in combination with other antibodies to create nanocomposites for various applications such as glycation studies and visualization of actin filaments and collagen. Its high specificity and sensitivity make it an invaluable tool for researchers in the field.</p>

<p>Rabbit polyclonal NR2C2 antibody</p>

<p>SPON2 antibody was raised using the middle region of SPON2 corresponding to a region with amino acids GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV</p>

<p>Gentamicin-BSA is a unique monoclonal antibody that has been conjugated with bovine serum albumin (BSA). This conjugate is designed to specifically target and bind to epidermal growth factor (EGF) receptors on the surface of cells. By binding to these receptors, Gentamicin-BSA can inhibit the activity of farnesyl transferase, an enzyme involved in cell growth and division.</p>

<p>Mouse monoclonal PANK2 antibody</p>

<p>EDNRB antibody was raised in sheep using C-terminal peptide KANDHGYDNFRSSNN of rat ET(B) Receptor corresponding to amino acids 424 to 437 conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SCFD2 antibody</p>

<p>Mouse monoclonal AGAP1 antibody</p>

<p>The LOX antibody is a monoclonal antibody that specifically targets pancreatic glucagon. It works by binding to insulin and preventing it from interacting with its receptor, thereby reducing the levels of insulin in the body. This antibody has been activated and modified to form a colloidal solution, making it highly effective in targeting and neutralizing insulin.</p>

<p>Mouse monoclonal DTYMK antibody</p>

<p>HLADR antibody was raised in mouse using the CESS cell line as the immunogen.</p>

<p>Purified Polyclonal COL5A1 antibody</p>

<p>Mouse monoclonal SYNJ2BP antibody</p>

<p>Sheep polyclonal Megestrol acetate antibody</p>

<p>Rabbit polyclonal WEE2 antibody</p>

<p>SOX7 antibody was raised in rabbit using the middle region of SOX7 as the immunogen</p>

<p>Rat monoclonal PD1 antibody (FITC)</p>

<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>