Produits biochimiques et réactifs

<p>ZNF584 antibody was raised in rabbit using the middle region of ZNF584 as the immunogen</p>

<p>Rabbit polyclonal MAPKAPK2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, inhibiting transcription and replication processes in bacteria. Extensive research has shown its high efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Remarkably, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity towards Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>The EpCAM antibody is a retinoid that exhibits cytotoxic properties. It belongs to the class of Monoclonal Antibodies and has been shown to inhibit the production of tumor necrosis factor-α (TNF-α). This antibody specifically targets EpCAM, a protein that is highly expressed in cancer cells, particularly in breast cancer (MCF-7). By binding to EpCAM, the antibody inhibits cell growth and induces apoptosis. Additionally, this antibody has been found to modulate hepatocyte growth factor/fibroblast growth factor signaling pathways, which are involved in cell proliferation and migration. The EpCAM antibody can also interact with other extracellular matrix components such as creatine, collagen, and fibronectin. Its multidrug resistance inhibitors have shown promising results in preclinical studies, making it a potential therapeutic option in the field of Life Sciences. With its high specificity and low viscosity, the EpCAM antibody offers great potential for targeted therapy against various types of cancer.</p>

<p>Mouse monoclonal CD163 antibody (biotin)</p>

<p>Purified Polyclonal Cytochrome P450 2A13 antibody</p>

<p>BSA conjugated Ciprofloxacin Hapten</p>

<p>APOL6 antibody was raised in rabbit using the middle region of APOL6 as the immunogen</p>

<p>Rabbit polyclonal FUS antibody (HRP)</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>C19ORF28 antibody was raised using the N terminal Of C19Orf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV</p>

<p>CDKN2AIP antibody was raised using the N terminal of CDKN2AIP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN</p>

<p>CA12 antibody was raised in Rabbit using Human CA12 as the immunogen</p>

<p>HBP1 antibody was raised in rabbit using the N terminal of HBP1 as the immunogen</p>

<p>The Trx antibody is a highly specific monoclonal antibody that targets a particular molecule. It is known for its neutralizing properties and its ability to bind to the target molecule with high affinity. The Trx antibody is commonly used in Life Sciences research, particularly in the field of Monoclonal Antibodies.</p>

<p>Recombinant Human SERPINB4 protein (His tag)</p>

<p>Rabbit polyclonal EIF4E3 antibody</p>

<p>RFXAP antibody was raised in mouse using recombinant Regulatory Factor X-Associated Protein (Rfxap)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>4-((5-Allyl-2-phenyl-6-(trifluoromethyl)pyrimidin-4-yl)(methyl)amino)benzoic acid is a peptide that has been shown to activate ion channels, as well as inhibit the binding of ligands to receptors. It is also an inhibitor of protein interactions in cell biology and pharmacology. This product is used primarily as a research tool for studying ion channel function.</p>

<p>The Actin antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets actin filaments, which are essential for cell structure and movement. It can be used in a variety of applications, including immunofluorescence, immunohistochemistry, and Western blotting.</p>

<p>Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.</p>

<p>MYB antibody was raised in rabbit using the N terminal of MYB as the immunogen</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2)  polyclonal Antibody</p>

<p>Microginin-d4 is a potent inhibitor that targets the cell cycle and induces apoptosis in human cancer cells. This unique compound has shown promising results in inhibiting tumor growth, particularly in cases of leukemia. Microginin-d4 works by inhibiting kinase activity, which is essential for cancer cell proliferation. This compound is derived from Chinese medicinal herbs and has been isolated from urine samples. Microginin-d4 has also shown to be a promising anticancer agent due to its ability to inhibit protein synthesis and other key pathways involved in cancer cell survival. Its potential as an effective treatment for various types of cancer makes it an exciting area of research in the field of oncology.</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>Rabbit polyclonal UBXN1 antibody</p>

<p>The KRT8 antibody is a monoclonal antibody used in life sciences research. It specifically targets and binds to keratin 8 (KRT8), a protein found in epithelial cells. This antibody has been widely used in various bioassays and studies to detect the presence of KRT8 in different tissues and cell types. Additionally, it has shown potential therapeutic applications, such as in the development of targeted therapies for certain types of cancer.</p>

<p>Rabbit polyclonal IL6 antibody (HRP)</p>

<p>The ATP6AP1 antibody is a highly specialized antibody that targets the ATP6AP1 protein. This protein is involved in various biological processes, including dopamine synthesis and secretion. The ATP6AP1 antibody has been extensively studied and found to be an effective tool for research purposes.</p>

<p>PDE1C antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>The Erythromycin antibody is a polyclonal antibody that specifically targets erythromycin, a macrolide antibiotic used in the treatment of various bacterial infections. This antibody has been extensively tested and shown to have high specificity and affinity for erythromycin. It can be used in various life science applications, including neutralizing erythromycin activity, detecting its presence in samples through immunohistochemistry or Western blotting, and studying its mechanism of action.</p>

<p>The CDK2 antibody is a highly effective tool for researchers in the field of life sciences. This monoclonal antibody specifically targets and binds to the activated form of CDK2, a crucial protein involved in cell cycle regulation. By inhibiting the activity of CDK2, this antibody can effectively block cell proliferation and growth.</p>

<p>OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG</p>

<p>Goat anti-mouse IgG (Fab'2) (FITC) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>

<p>Mouse monoclonal Cytokeratin AE1+AE3 antibody</p>

<p>PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP</p>

<p>Purified Polyclonal NEUROD2 antibody</p>

<p>The KSP Cadherin antibody is a highly specific antibody that targets the KSP (Kidney-Specific Protein) Cadherin. This transmembrane glycoprotein plays a crucial role in pluripotent stem cell differentiation and development. The antibody has been extensively studied and found to be effective in various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>1-391 amino acids: MGSSHHHHHH SSGLVPRGSH MSGPVPSRAR VYTDVNTHRP REYWDYESHV VEWGNQDDYQ LVRKLGRGKY SEVFEAINIT NNEKVVVKIL KPVKKKKIKR EIKILENLRG GPNIITLADI VKDPVSRTPA LVFEHVNNTD FKQLYQTLTD YDIRFYMYEI LKALDYCHSM GIMHRDVKPH NVMIDHEHRK LRLIDWGLAE FYHPGQEYNV RVASRYFKGP ELLVDYQMYD YSLDMWSLGC MLASMIFRKE PFFHGHDNYD QLVRIAKVLG TEDLYDYIDK YNIELDPRFN DILGRHSRKR WERFVHSENQ HLVSPEALDF LDKLLRYDHQ SRLTAREAME HPYFYTVVKD QARMGSSSMP GGSTPVSSAN MMSGISSVPT PSPLGPLAGS PVIAAANPLG MPVPAAAGAQ Q</p>

<p>Recombinant Human ATP6V1F protein (His tag)</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL</p>

<p>Purified recombinant Human MAVS protein (His tag)</p>

<p>Purified Rabbit polyclonal IL2R beta antibody</p>

<p>FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV</p>

<p>Mouse monoclonal CD51/61 antibody (FITC)</p>

<p>Mouse monoclonal SSR1 antibody</p>

<p>Rabbit polyclonal UBE2Q2 antibody</p>

<p>The ALDH1B1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed to target hematopoietic stem cells. This chromogenic antibody is widely used in research and diagnostic applications to detect the presence of ALDH1B1 antigen.</p>

<p>WDHD1 antibody was raised in rabbit using the middle region of WDHD1 as the immunogen</p>

<p>Purified Rabbit polyclonal POLE4 antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The CRYAB antibody is a monoclonal antibody that targets CRYAB, also known as alpha-crystallin B chain. This antibody is widely used in Life Sciences research to study the function and expression of CRYAB. CRYAB is a small heat shock protein that plays a crucial role in protecting cells from oxidative damage and maintaining cellular homeostasis. It is highly expressed in tissues such as the heart, skeletal muscles, and lens of the eye. The CRYAB antibody can be used for various applications including Western blotting, immunohistochemistry, and flow cytometry to detect and quantify CRYAB levels in different samples. Its high specificity and sensitivity make it an essential tool for researchers studying oxidative stress, protein aggregation, and neurodegenerative diseases.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>IFN beta antibody was raised in rabbit using human interferon beta as the immunogen.</p>

<p>The HDAC8 antibody is a monoclonal antibody that belongs to the class of inhibitors. It is used in Life Sciences for various applications, including research and diagnostics. This antibody specifically targets HDAC8, which is a member of the histone deacetylase family. HDAC8 plays a crucial role in regulating gene expression by removing acetyl groups from histones, thereby affecting chromatin structure and transcriptional activity. The HDAC8 antibody can be used to study the function of HDAC8 in different biological processes, such as cell proliferation, differentiation, and apoptosis. It has also been used in combination with other antibodies or drugs to explore potential therapeutic strategies for various diseases, including cancer and neurodegenerative disorders. With its high specificity and affinity, the HDAC8 antibody offers researchers a valuable tool for understanding the molecular mechanisms underlying these conditions and developing targeted therapies.</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody that targets the protein isoform CYP2J2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to neutralize the activity of CYP2J2, which plays a crucial role in the metabolism of arachidonic acid and other bioactive lipids.</p>

<p>Sheep polyclonal 17a Testosterone antibody</p>

<p>Mouse monoclonal ALPP antibody</p>

<p>Rabbit polyclonal ACK1 antibody (Tyr284)</p>

<p>GPD2 antibody was raised in Rabbit using Human GPD2 as the immunogen</p>

<p>Goat anti Rabbit IgG (H + L) secondary antibody (FITC); IF: 1:50-1:200 FC: 1:1,000-1:10,000;Does not crossreact with other non-immunoglobulin serum proteins.. Has minimum cross reactivity with human, bovine, mouse, and horse serum proteins</p>

<p>Rabbit polyclonal RPL10A antibody</p>

<p>ST271 is a novel, potent and selective inhibitor of bacterial DNA-dependent RNA polymerase. It has been shown to be active against Gram-positive bacteria that are resistant to ceftriaxone and erythromycin, including methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococci (VRE). ST271 blocks the synthesis of proteins by inhibiting the enzyme ribosome. This drug also has anti-inflammatory properties, which may be due to its ability to inhibit epidermal growth factor receptor phosphorylation.</p>

<p>Purified recombinant MRPL13 protein (His tag)</p>

<p>Desferrithiocin is a natural product that has been shown to have anti-cancer activity. It inhibits cancer by inhibiting the expression of β-catenin, which is essential for cancer cell proliferation and survival. Desferrithiocin also has anti-inflammatory effects, which may be due to its ability to inhibit iron uptake in macrophages. This leads to a decrease in the production of proinflammatory cytokines and chemokines that can cause inflammation. Desferrithiocin has been found to be orally bioavailable and nontoxic in animal studies.</p>

<p>Purified Rabbit polyclonal EFCAB7 antibody</p>

<p>ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV</p>

<p>DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML</p>

<p>Purified Polyclonal MRPL21 antibody</p>

<p>Mouse monoclonal LAMB2 antibody</p>

<p>Salinomycin Conjugate for use in immunoassays</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>ITGA4 antibody was raised in Rabbit using Human ITGA4 as the immunogen</p>

<p>The Toll-like receptor 2 antibody is a powerful tool in Life Sciences research. It is a monoclonal antibody that specifically targets Toll-like receptor 2 (TLR2), an important component of the innate immune system. TLR2 plays a crucial role in recognizing and responding to microbial pathogens, making it an attractive target for therapeutic interventions.</p>

<p>High sensitivity TMB Substrate for use in high sensitivity immunoassays designed in 3D-IF format</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF488 antibody, catalog no. 70R-8442</p>

<p>CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface glycoprotein expressed on activated leukocytes. This antibody has antiangiogenic properties and can induce apoptosis in tumor cells by binding to the necrosis factor-related apoptosis-inducing ligand (TRAIL). CD11b antibody can be used in various applications, including immunoprecipitation, Western blotting, and flow cytometry. It has been shown to inhibit the adhesion of leukocytes to endothelial cells and block the migration of leukocytes into inflamed tissues. Additionally, CD11b antibody can be used for the detection of CD11b in nuclear extracts and human serum samples. Its high specificity and affinity make it a valuable tool in Life Sciences research and diagnostic applications.</p>

<p>TRIM23 antibody was raised in rabbit using the N terminal of TRIM23 as the immunogen</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>CD144 antibody is a monoclonal antibody that specifically targets CD144, also known as vascular endothelial cadherin (VE-cadherin). It plays a crucial role in maintaining the integrity and stability of endothelial cell-cell junctions. CD144 antibody can be used in various life science research applications, including the study of interleukin-6 signaling, influenza hemagglutinin binding assays, and the detection of reactive oxygen species.</p>

<p>Purified Polyclonal Alpha actin 1 antibody</p>

<p>The REDD1 antibody is a highly specialized product used in Life Sciences research. It is an immunogenic composition designed to target and detect the presence of REDD1 protein in various biological samples. The REDD1 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable tool for researchers studying the role of REDD1 in different cellular processes.</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>Rabbit polyclonal TIMM9 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.</p>

<p>EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Tau antibody (Ser214)</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>The NGAL antibody is a powerful multidrug antibody that has been specifically designed to target and neutralize activated antibodies in the body. This unique antibody has shown great potential in the field of Life Sciences, particularly in the development of monoclonal antibodies for therapeutic purposes. The NGAL antibody has been found to inhibit the activity of necrosis factor-related apoptosis-inducing antibodies, which are known to play a critical role in various diseases.</p>

<p>The GPR75 antibody is a powerful tool used in the field of life sciences. It specifically targets glucagon, a hormone involved in regulating glucose levels in the body. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Attractin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>EBF3 antibody was raised in rabbit using the middle region of EBF3 as the immunogen</p>

<p>Mouse monoclonal MHC Class I antibody (allophycocyanin)</p>

<p>Rabbit polyclonal Raf1 antibody (Ser259)</p>