Produits biochimiques et réactifs

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Haloperidol Conjugate for use in immunoassays</p>

<p>The HSV2 protein is a recombinant protein that falls under the category of Recombinant Proteins &amp; Antigens. It is a mitogen-activated protein that activates protein tyrosine kinases in various cellular processes. This protein has been extensively studied and is commonly used in research laboratories and life sciences.</p>

<p>Mouse monoclonal C15orf40 antibody</p>

<p>FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ</p>

<p>Hdac3 antibody was raised in rabbit using the C terminal of Hdac3 as the immunogen</p>

<p>SLC25A28 antibody was raised using the C terminal of SLC25A28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST</p>

<p>Purified recombinant RWDD4 protein (His tag)</p>

<p>CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal p300 antibody (Ser89)</p>

<p>Rabbit polyclonal TAF1B antibody</p>

<p>Rabbit polyclonal MYH14 antibody</p>

<p>The MAOA antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of the MAOA enzyme. This enzyme plays a crucial role in various physiological processes, including the regulation of lipoprotein lipase, interleukin-6, and adipose tissue metabolism. By inhibiting MAOA activity, this antibody has been shown to have significant effects on cellular processes such as fas-mediated apoptosis, phosphatase activity, actin filament organization, and erythropoietin signaling.</p>

<p>IVNS1ABP antibody was raised in Rabbit using Human IVNS1ABP as the immunogen</p>

<p>Rabbit polyclonal PKAR2 beta antibody (Ser113)</p>

<p>Mouse monoclonal CD199 antibody (FITC)</p>

<p>Rabbit polyclonal WRKY37 antibody</p>

<p>Hemoglobin A1c antibody is a monoclonal antibody used in Life Sciences. It is specifically designed to target and bind to Hemoglobin A1c, a variant of hemoglobin that is formed when glucose binds to hemoglobin in the blood. This antibody can be used for various applications, including research and diagnostic purposes.</p>

<p>Rabbit polyclonal ADD1 antibody (Ser726)</p>

<p>The CD5 antibody is a monoclonal antibody that targets the CD5 protein isoforms. It contains disulfide bonds and has a reactive linker group that allows it to bind to specific protein-protein interactions. This antibody can be used in various applications in the field of life sciences, including the study of pluripotent cells, colony-stimulating factors, and growth factors. Additionally, the CD5 antibody has cytotoxic properties and can be utilized for targeted therapy against certain diseases. Its recombinant vaccinia formulation enhances its efficacy, making it an ideal choice for researchers and scientists working in the field of immunology and cell biology.</p>

<p>Recombinant Human ST6GAL1 protein (His tag)</p>

<p>The Cyclin D3 antibody is a highly specialized monoclonal antibody that targets the insulin growth factor pathway. It specifically binds to cyclin D3, a protein involved in cell cycle regulation and cell proliferation. By inhibiting the interaction between cyclin D3 and its receptors, this antibody effectively blocks the signaling pathway, preventing the growth and division of cancer cells.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Purified Polyclonal Carbonic Anhydrase 9 antibody</p>

<p>Rabbit polyclonal ZNF597 antibody</p>

<p>Rabbit polyclonal UNC13D antibody</p>

<p>The GLI2 antibody is a polyclonal antibody that specifically targets tyrosine residues in the GLI2 protein. It is commonly used in life sciences research for applications such as immunohistochemistry and Western blotting. This antibody has been shown to be effective in detecting GLI2 expression in various tissues and cell types. Additionally, it can be used to study the role of GLI2 in different biological processes, including insulin signaling and the activation of TRPV4. The GLI2 antibody is a valuable tool for researchers studying GLI2 function and its involvement in cellular processes. With its high specificity and sensitivity, this antibody provides reliable results for both basic research and clinical applications.</p>

<p>The CD80 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets CD80, a protein involved in immune responses. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The CK17 antibody is a highly specific monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the expression and localization of this important target molecule. The CK17 antibody has been shown to bind specifically to collagen, a major component of connective tissues, and can be used to detect collagen expression in various cell types. Additionally, this antibody has been used to study the regulation of messenger RNA (mRNA) levels for hepatocyte growth factor and ferritin, which are involved in iron homeostasis. The CK17 antibody derivative also inhibits the activity of steroid hormones and growth factors, making it a valuable tool for studying their effects on cellular processes. With its high specificity and versatility, the CK17 antibody is an essential reagent for any researcher working in the field of molecular biology or immunology.</p>

<p>Mouse monoclonal Phycoerythrin antibody (biotin)</p>

<p>Purified recombinant ORM2 protein (His tag)</p>

<p>MAETDPKTVQ DLTSVVQTLL QQMQDKFQTM SDQIIGRIDD MSSRIDDLEK NIADLMTQAG VEELESENKI PATQKS</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3,17-dione-11-protein conjugate as the immunogen.</p>

<p>APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS</p>

<p>RELM beta antibody was raised in using highly pure recombinant human RELMbeta as the immunogen.</p>

<p>MYOD1 antibody was raised in Mouse using a purified recombinant fragment of human MYOD1 expressed in E. coli as the immunogen.</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>

<p>Purified recombinant EAF1 protein (His tag)</p>

<p>Armenian Hamster monoclonal FceRI alpha antibody (FITC)</p>

<p>The Glutamine Synthetase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in growth factor signaling, particularly in the regulation of alpha-fetoprotein and anti-VEGF pathways. This acidic antibody exhibits strong anticoagulation and antiangiogenic properties, making it an essential tool for studying endothelial growth and erythropoietin production.</p>

<p>Rabbit polyclonal TMEM176B antibody</p>

<p>TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH</p>

<p>Rabbit polyclonal TADA3 antibody (FITC)</p>

<p>Rabbit polyclonal NOS1 antibody</p>

<p>Protein S Antibody Pair for detection of Human Protein S in ELISA</p>

<p>MAP4K4 antibody was raised in Rabbit using Human MAP4K4 as the immunogen</p>

<p>The RBBP8 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ryanodine receptor, a protein involved in calcium release from intracellular stores. This antibody has been shown to neutralize the activity of the ryanodine receptor, preventing its interaction with other proteins and inhibiting its function. In addition, the RBBP8 antibody has reactive properties, allowing it to bind to specific acid residues on target proteins. This antibody has been used in studies investigating potassium channels, ischemia reperfusion injury, and neurokinin-1 receptor signaling. Its application in research has provided valuable insights into oxidative damage and ascorbic acid metabolism. The RBBP8 antibody is a powerful tool for scientists studying various biological processes and pathways.</p>

<p>DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD</p>

<p>CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH</p>

<p>RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.</p>

<p>The VEGFR3 antibody is a highly effective medicament that targets the glucan synthase and growth factor. It belongs to the class of Monoclonal Antibodies, which are known for their specificity and potency. This antibody specifically binds to epidermal growth factor (EGF) receptors on the apical membrane of cells, inhibiting their activation. By blocking the activity of EGF receptors, this monoclonal antibody prevents the binding of other cell antibodies and autoantibodies, thereby reducing inflammation and promoting healing. Additionally, studies have shown that the VEGFR3 antibody has antiviral properties and can help alleviate hepatic steatosis. With its wide range of applications in various pharmaceutical preparations, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant UQCRC1 protein (His tag)</p>

<p>Hsp40 antibody was raised in mouse using recombinant human Hsp40(1-340aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal ICT1 antibody</p>

<p>Purified Recombinant PSMD5 protein (His tagged)</p>

<p>SPIC antibody was raised in rabbit using the middle region of SPIC as the immunogen</p>

<p>CLASP2 antibody was raised in Rat using alpha-CLASP2-N-terminus and GST fusion protein as the immunogen.</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>The MUC1 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal antibody that targets the chemokine receptor expressed on the surface of cells. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG</p>

<p>Rabbit polyclonal RHCG antibody</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Aquaporin 2 antibody is a highly specialized polyclonal antibody that is designed to specifically target and neutralize the aquaporin 2 protein. Aquaporin 2 is a membrane protein that plays a crucial role in water transport across cell membranes. This antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The aquaporin 2 antibody is produced using a combination of streptavidin and monoclonal antibodies that have been carefully selected for their high affinity and specificity towards the aquaporin 2 protein. This powerful combination ensures accurate and reliable results in your experiments. Whether you are studying the role of aquaporin 2 in kidney function or investigating its involvement in certain diseases, this antibody will provide you with the tools you need to advance your research. Trust in our aquaporin 2 antibody to deliver exceptional performance and help you uncover new insights into cellular water</p>

<p>(-)-Acylfulvene is an analog of the natural product xylan, which has been shown to induce apoptosis in cancer cells. It is a potent inhibitor of protein kinases and has demonstrated anticancer activity in vitro and in vivo. (-)-Acylfulvene has been found to be effective against a wide range of human cancers, including tumors of the breast, lung, colon, and prostate. This compound has also been studied as a potential treatment for urinary bladder cancer due to its ability to inhibit the growth of cancer cells. As a promising class of anticancer agents, (-)-Acylfulvene and its derivatives are being investigated as kinase inhibitors and tumor growth inhibitors with potential therapeutic applications in cancer treatment.</p>

<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>

<p>AFM antibody was raised in rabbit using the C terminal of AFM as the immunogen</p>

<p>HARS antibody was raised in mouse using recombinant Histidyl-Trna Synthetase</p>

<p>Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ</p>

<p>Purified recombinant EXOSC7 protein (His tag)</p>

<p>The JEV NS1 protein is a diindolylmethane-related inhibitor that plays a crucial role in hybridization with proteins and antigens. It can be biotinylated and used in conjunction with streptavidin for various applications. The protein has been found to interact with indole-3-carbinol and antibodies, forming conjugated proteins. It contains a disulfide bond and is positively charged due to the presence of cations. The JEV NS1 protein also exhibits interactions with epidermal growth factor, reactive oxygen species, retinoid, and mineralization processes. Its versatile nature makes it an essential tool for researchers in various fields.</p>

<p>Please enquire for more information about MIEN1 protein (His tag) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hexokinase 1 + 2 antibody was raised in mouse using recombinant human Hexokinase 2 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Alcohol dehydrogenase antibody was raised in rabbit using full length Alcohol Dehydrogenase isolated from yeast as the immunogen.</p>

<p>MDVFMKGLSM AKEGVVAAAE KTKQGVTEAA EKTKEGVLYV GSKTREGVVQ GVASVAEKTK EQASHLGGAV FSGAGNIAAA TGLVKREEFP TDLKPEEVAQ EAAEEPLIEP LMEPEGESYE DPPQEEYQEY EPEA</p>

<p>ID1 antibody was raised in Rabbit using Human ID1 as the immunogen</p>

<p>Rabbit Polyclonal GNAT2 antibody</p>

<p>Lyn antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the Lyn protein, which plays a crucial role in various cellular processes such as signal transduction and immune response. The Lyn antibody has been extensively studied for its potential antiviral and cytotoxic properties. It has shown promising results in inhibiting the replication of certain viruses by targeting specific viral proteins, such as the circumsporozoite protein in malaria parasites. Additionally, the Lyn antibody has been found to interact with β-catenin, a key component of cell-cell adhesion and signaling pathways. This interaction may have implications in cancer research and therapeutics. With its high specificity and affinity, the Lyn antibody is an invaluable tool for researchers studying immune responses, signal transduction pathways, and various diseases at the molecular level.</p>

<p>Rabbit polyclonal UBE1L antibody</p>

<p>Purified recombinant LANCL1 protein (His tag)</p>

<p>Rabbit polyclonal MRGRF antibody</p>

<p>Mouse monoclonal RUVBL2 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>The SPACA3 antibody is a powerful tool in Life Sciences research. It belongs to the class of polyclonal antibodies and has been extensively studied for its ability to neutralize various factors involved in cellular processes. This antibody has shown natriuretic activity, indicating its potential role in regulating fluid balance in the body. Additionally, it has been found to inhibit the action of tumor necrosis factor-alpha (TNF-α), a key player in inflammation.</p>

<p>Rabbit polyclonal ILK antibody (Ser246)</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF21 antibody, catalog no. 70R-7549</p>

<p>Rabbit polyclonal YPEL1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, effectively inhibiting bacterial growth. Its efficacy has been proven through various scientific techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes several transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Purified Polyclonal DNA Polymerase beta antibody</p>

<p>Rabbit polyclonal Cathepsin B antibody (HRP)</p>

<p>ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL</p>

<p>Purified recombinant ORC6 protein (His tag)</p>

<p>IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.</p>

<p>Rabbit polyclonal DNA Polymerase theta antibody</p>

<p>Recombinant Human STK11 protein (His tag)</p>