Produits biochimiques et réactifs

<p>Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL</p>

<p>Rabbit polyclonal Catenin beta antibody (Tyr654)</p>

<p>The alpha Tubulin antibody is a monoclonal antibody that specifically targets and neutralizes alpha-tubulin, a protein involved in the formation of actin filaments. This antibody has been shown to have high affinity for alpha-tubulin and can effectively inhibit its activity. It has also been demonstrated to bind to other proteins such as alpha-fetoprotein and receptors, further highlighting its versatility.</p>

<p>Drying Buffer/Stabilizer, biotin-free, BSA based, ready-to-use</p>

<p>PRMT2 antibody was raised using the middle region of PRMT2 corresponding to a region with amino acids VHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIW</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLT3LG antibody, catalog no. 70R-7181</p>

<p>The Biotin antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that has been specifically designed for biotinylation purposes. This antibody is commonly used in various research applications such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.</p>

<p>Purified recombinant PHB protein (His tag)</p>

<p>Rabbit polyclonal BTF3 antibody (biotin)</p>

<p>NBL1 antibody was raised using the middle region of NBL1 corresponding to a region with amino acids GLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE</p>

<p>Rabbit polyclonal SUGT1 antibody</p>

<p>OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS</p>

<p>The CHAT antibody is a monoclonal antibody that targets the oncogene homolog, β-catenin. It is activated by adeno-associated virus and has been widely used in Life Sciences research. This antibody specifically binds to the target molecule, inhibiting its activity and preventing downstream effects. The CHAT antibody has also shown promising results in studies involving steroid-induced apoptosis, caspase-9 activation, and cholinergic signaling pathways. With its high specificity and effectiveness, this antibody is a valuable tool for researchers studying various biological processes and diseases such as cryptosporidium infection.</p>

<p>The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.</p>

<p>Rabbit polyclonal RUNX1T1 antibody</p>

<p>alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids  DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The FXN antibody is a highly effective medicament that exhibits cytotoxic properties. It is administered through the use of adeno-associated virus vectors, which deliver the monoclonal antibody directly to targeted cells. The FXN antibody specifically targets tumor necrosis factor-alpha (TNF-α), a protein known to play a crucial role in inflammation and cell death processes. By binding to TNF-α, this monoclonal antibody effectively inhibits its activity and prevents the progression of inflammatory diseases.</p>

<p>Mouse monoclonal MRI1 antibody</p>

<p>PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE</p>

<p>ZNF264 antibody was raised in rabbit using the C terminal of ZNF264 as the immunogen</p>

<p>Myosin antibody was raised in mouse using chicken muscle cells as the immunogen.</p>

<p>Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP</p>

<p>The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.</p>

<p>Rabbit polyclonal UBE2E3 antibody</p>

<p>The TPT1 protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes, such as hemolysis, growth factor signaling, and carbonic anhydrase activity. This protein has gained significant attention due to its unique characteristics.</p>

<p>Zfp90 antibody was raised in rabbit using the N terminal of Zfp90 as the immunogen</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>Mouse monoclonal CAPZA1 antibody</p>

<p>Perilipin antibody was raised in mouse using synthetic peptide of perilipin as the immunogen.</p>

<p>Rabbit polyclonal TNFSF9 antibody (biotin)</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>The ATM antibody is a highly specialized monoclonal antibody that targets specific antigens in the human body. It is primarily used in the field of life sciences for research purposes and has shown great potential in various applications.</p>

<p>Recombinant Human BDNF protein (His tag)</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Mouse monoclonal ALDOB antibody</p>

<p>SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE</p>

<p>Rabbit Polyclonal CLIP4 antibody</p>

<p>The Caspase 3 antibody is a highly effective neutralizing agent that belongs to the class of monoclonal antibodies. It is widely used in Life Sciences research and has proven to be invaluable in various applications. The Caspase 3 antibody works by binding to the enzyme caspase 3, which plays a crucial role in the process of programmed cell death (apoptosis). By neutralizing caspase 3, this antibody effectively prevents the activation of downstream apoptotic pathways.</p>

<p>Canine RBC antibody (FITC) was raised in rabbit using canine erythrocytes as the immunogen.</p>

<p>Mouse monoclonal PSMB7 antibody</p>

<p>LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS</p>

<p>Purified recombinant MMP13 protein (His tag)</p>

<p>FGF21 antibody is a monoclonal antibody that belongs to the class of antibodies used in Life Sciences. It specifically targets and inhibits the activity of vascular endothelial growth factor (VEGF), a growth factor involved in angiogenesis. This antibody has been shown to be effective in blocking the activation of VEGF, thereby preventing the formation of new blood vessels. FGF21 antibody also exhibits anticoagulant properties by inhibiting platelet aggregation, making it useful for conditions such as heparin-induced thrombocytopenia. Additionally, this antibody has natriuretic effects and can regulate fluid balance in the body. With its antiangiogenic properties, FGF21 antibody holds great potential for therapeutic applications in various diseases related to abnormal blood vessel growth.</p>

<p>Slc6a9 antibody was raised in rabbit using the C terminal of Slc6a9 as the immunogen</p>

<p>LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK</p>

<p>The SERPINA1 antibody is an insulin-like monoclonal antibody that has been immobilized for use in various applications. It can be used to detect and quantify interferon (IFN)-gamma, a growth factor involved in immune response. The antibody can also be used to study the function of recombinant proteins and their interactions with alpha-synuclein, a protein associated with neurodegenerative disorders. Additionally, the SERPINA1 antibody can be used to detect and measure activated antibodies and monitor antigen-antibody interactions. It has also been shown to play a role in sumoylation and fatty acid metabolism. With its versatile applications, this antibody is a valuable tool for researchers in various fields.</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>The ZMYND8 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target a specific molecule called ZMYND8, which has been found to be associated with thrombocytopenia. This condition is characterized by low levels of platelets in the blood, leading to increased risk of bleeding and bruising.</p>

<p>Phenobarbital m/p Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal ADRA1A antibody</p>

<p>BCAT1 antibody was raised in Rabbit using Human BCAT1 as the immunogen</p>

<p>The CD15 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor CD15. It has been extensively studied for its potential therapeutic applications in various fields, including autoantibodies, interferon, and growth factor research. This antibody has shown great promise in neutralizing the effects of CD15, thereby inhibiting the activity of this chemokine receptor.</p>

<p>CAPG antibody was raised in Rabbit using Human CAPG as the immunogen</p>

<p>HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV</p>

<p>ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen</p>

<p>FAM120A antibody was raised using the middle region of FAM120A corresponding to a region with amino acids SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAE</p>

<p>The Nod2 antibody is a highly specialized monoclonal antibody that binds to the Nod2 receptor. This receptor is involved in various cellular processes and plays a crucial role in immune responses. The Nod2 antibody has been extensively studied and proven to have high affinity and specificity for its target.</p>

<p>Rabbit polyclonal LAMB2 antibody</p>

<p>The DHPS antibody is a highly specific monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It plays a crucial role in regulating cell growth, proliferation, and survival. This antibody has been extensively studied in Life Sciences research and has proven to be an invaluable tool for studying various cellular processes.</p>

<p>Rabbit polyclonal SYN1 antibody (Ser605)</p>

<p>BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS</p>

<p>Rabbit polyclonal TIN2 antibody</p>

<p>Purified lactoferrin from human milk.</p>

<p>The HAT antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to collagen, a protein found in connective tissues. The HAT antibody can be used in various applications, including immunoassays and cytotoxicity studies. It has been shown to have neutralizing properties against trypsin-like protease, which plays a role in tissue lysis. Additionally, the HAT antibody has been found to inhibit reactive oxygen species production and lipid peroxidation, making it useful for studying oxidative stress-related processes. With its high specificity and affinity for collagen, this antibody is a valuable tool for researchers working in the field of cell biology and molecular biology.</p>

<p>CDR2L antibody was raised in rabbit using the C terminal of CDR2L as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4E antibody, catalog no. 70R-4682</p>

<p>Mouse monoclonal CD11c antibody (allophycocyanin)</p>

<p>LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL</p>

<p>The USP7 antibody is a monoclonal antibody that targets the USP7 protein. It has been shown to have a wide range of applications in the field of Life Sciences. This antibody specifically binds to USP7 and inhibits its activity, which plays a crucial role in various cellular processes including IFN-gamma signaling, fatty acid metabolism, siderophore production, and superoxide regulation.</p>

<p>ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW</p>

<p>1-318 amino acids: MGSSHHHHHH SSGLVPRGSH MPNIKIFSGS SHQDLSQKIA DRLGLELGKV VTKKFSNQET CVEIGESVRG EDVYIVQSGC GEINDNLMEL LIMINACKIA SASRVTAVIP CFPYARQDKK DKSRAPISAK LVANMLSVAG ADHIITMDLH ASQIQGFFDI PVDNLYAEPA VLKWIRENIS EWRNCTIVSP DAGGAKRVTS IADRLNVDFA LIHKERKKAN EVDRMVLVGD VKDRVAILVD DMADTCGTIC HAADKLLSAG ATRVYAILTH GIFSGPAISR INNACFEAVV VTNTIPQEDK MKHCSKIQVI DISMILAEAI RRTHNGESVS YLFSHVPL</p>

<p>Plasmin protein is a pegylated, neutralizing growth factor that plays a crucial role in various Life Sciences applications. It is commonly used in the field of Proteins and Antigens for its ability to promote the growth and differentiation of mesenchymal stem cells. Additionally, plasmin protein has been found to have intraocular effects and can be used in the development of antibodies, including monoclonal antibodies.</p>

<p>ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen</p>

<p>Purified recombinant SNURF protein (His tag)</p>

<p>Rabbit polyclonal SAP18 antibody</p>

<p>The SFTPB Antibody is an activated antibody that serves as a serum marker for various medical conditions. It specifically targets cardiomyocytes and can be used to detect the presence of autoantibodies in the blood. This antibody has also been utilized in the field of regenerative medicine, particularly in studies involving pluripotent stem cells. The SFTPB Antibody is a glycoprotein that interacts with specific receptors on cell membranes, resulting in the activation of transmembrane conductance and facilitating the transmission of signals such as acetylcholine or other active agents. This versatile antibody is widely used in Life Sciences research and has proven to be an invaluable tool in understanding various physiological processes. The SFTPB Antibody is available as Polyclonal Antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.</p>

<p>Mouse monoclonal ATG3 antibody</p>

<p>Ractopamine 10 Conjugate for use in immunoassays</p>

<p>The TRIM2 antibody is a highly specialized monoclonal antibody that targets insulin and has neutralizing properties. It specifically binds to cholinergic receptors, inhibiting their activity and preventing the release of insulin. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS3ST1 antibody, catalog no. 70R-5492</p>

<p>ZBTB3 antibody was raised in rabbit using the middle region of ZBTB3 as the immunogen</p>

<p>Chloroquine N-oxide is an analog of Chloroquine that acts as a potent kinase inhibitor. It has been shown to have anticancer properties and can induce apoptosis in cancer cells. Chloroquine N-oxide has been found to be effective against a variety of human tumors, including lung, breast, and colon cancers. This drug inhibits the activity of hepcidin, a protein involved in iron metabolism, which may contribute to its anticancer effects. Additionally, Chloroquine N-oxide has been detected in the urine of Chinese patients with cancer who were treated with this drug. This suggests that it may have potential as an anticancer agent for humans.</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody</p>

<p>The BRS3 antibody is a polyclonal antibody that serves as an affinity ligand for extracellular substances. It is commonly used in the field of medicine to isolate retinal autoantibodies. The BRS3 antibody has been found to be effective in inhibiting DNA double-strand break repair and can be used as a tool for studying the mechanisms involved in this process. In addition, it has been shown to inhibit the growth of pluripotent stem cells and can be used in research related to their differentiation. The BRS3 antibody is often employed in immunohistochemical studies to detect the presence of certain markers or proteins in tissue samples. Its use in life sciences research has provided valuable insights into various biological processes and pathways.</p>

<p>Purified recombinant HMGN3 protein (His tag)</p>

<p>UBE2L6 antibody was raised in mouse using recombinant human UBE2L6 (1-152aa) purified from E. coli as the immunogen.</p>

<p>IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL</p>

<p>Prealbumin protein is a biochemical substance that is used for the treatment and/or prophylaxis of certain conditions. It can be quantitated using monoclonal antibodies specific to prealbumin protein. This protein contains histidine residues, which can serve as inhibitors of certain enzymes. Monoclonal antibody-based assays are commonly used in Life Sciences research to study the expression and function of prealbumin protein. Prealbumin protein is also known as transthyretin, a carrier protein for thyroid hormones and retinol-binding proteins. Native Proteins &amp; Antigens, including prealbumin protein, are widely used in various research applications such as Western blotting, ELISA, and immunohistochemistry. Additionally, prealbumin protein has been implicated in anti-angiogenesis processes and may be targeted by autoantibodies in certain autoimmune diseases.</p>

<p>The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.</p>

<p>Rat monoclonal Toll-like receptor 9 antibody (FITC)</p>

<p>Mouse monoclonal Cytokeratin 19 antibody (Prediluted for IHC)</p>

<p>BUD31 antibody was raised in Rabbit using Human BUD31 as the immunogen</p>

<p>PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP</p>

<p>KIFAP3 antibody was raised in Rabbit using Human KIFAP3 as the immunogen</p>

<p>BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)</p>

<p>LTF antibody was raised in Rabbit using Human LTF as the immunogen</p>