Produits biochimiques et réactifs

<p>WIF1 antibody was raised in Mouse using a purified recombinant fragment of human WIF1 expressed in E. coli as the immunogen.</p>

<p>PSA antibody was raised in mouse using highly pure human Free PSA as the immunogen.</p>

<p>Rabbit polyclonal WRKY65 antibody</p>

<p>Digoxin antibody was raised in mouse using digoxin-BSA as the immunogen.</p>

<p>The Mitochondria antibody is a monoclonal antibody that has neutralizing properties against interferon. It acts by inhibiting the activity of protein kinases and 3-kinase, which are involved in cellular processes such as acetylation and phosphorylation. The antibody is produced through hybridoma cell technology using cellulose as a substrate. It has been shown to react with taxol, a chemotherapy drug used in the treatment of various types of cancer. The Mitochondria antibody is widely used in the field of Life Sciences for research purposes and has proven to be highly effective in studies involving activated cells.</p>

<p>Sheep polyclonal Nitrazepam antibody</p>

<p>Rabbit polyclonal Chl71 antibody</p>

<p>PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ</p>

<p>IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG</p>

<p>Antithrombin III protein is a crucial component in the field of Life Sciences. It belongs to the group of Proteins and Antigens and is known for its anticoagulant properties. This protein acts as a natural inhibitor of activated clotting factors, thereby preventing excessive blood clot formation. Antithrombin III protein can be used as a therapeutic agent in various medical conditions, such as deep vein thrombosis, pulmonary embolism, and disseminated intravascular coagulation.</p>

<p>Diluent buffer/blocker for use in Poly-HRP enhanced enzymatic labelling of antibodies and antigens. Not biotin-free.</p>

<p>Alpha 2 macroglobulin antibody was raised in goat using human alpha2-macroglobulin as the immunogen.</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>MBD4 antibody was raised in Rabbit using Human MBD4 as the immunogen</p>

<p>TPX2 antibody was raised in mouse using recombinant Human Tpx2, Microtubule-Associated, Homolog (Xenopus Laevis) (Tpx2)</p>

<p>Purified Rabbit polyclonal LAT antibody (Tyr171)</p>

<p>Purified recombinant COMMD7 protein (His tag)</p>

<p>Purified native Human TBG protein</p>

<p>Purified recombinant STBD1 protein (His tag)</p>

<p>Purified recombinant CFB protein (His tag)</p>

<p>20-399 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMEEG LNFPTYDGKD RVVSLSEKNF KQVLKKYDLL CLYYHEPVSS DKVTQKQFQL KEIVLELVAQ VLEHKAIGFV MVDAKKEAKL AKKLGFDEEG SLYILKGDRT IEFDGEFAAD VLVEFLLDLI EDPVEIISSK LEVQAFERIE DYIKLIGFFK SEDSEYYKAF EEAAEHFQPY IKFFATFDKG VAKKLSLKMN EVDFYEPFMD EPIAIPNKPY TEEELVEFVK EHQRPTLRRL RPEEMFETWE DDLNGIHIVA FAEKSDPDGY EFLEILKQVA RDNTDNPDLS ILWIDPDDFP LLVAYWEKTF KIDLFRPQIG VVNVTDADSV WMEIPDDDDL PTAEELEDWI EDVLSGKINT EDDDEDDDDD DNSDEEDNDD SDDDDDE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it is metabolized in the body. Rifapentine specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits their growth. With its proven efficacy and multiple mechanisms of action, this drug offers a promising solution for combating tuberculosis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent against the activity of histone deacetylase 3 (HDAC3). It plays a crucial role in regulating gene expression by modifying chromatin structure. The HDAC3 antibody specifically targets and inhibits the enzymatic activity of HDAC3, preventing it from removing acetyl groups from histone proteins. This inhibition leads to increased histone acetylation, resulting in altered gene expression patterns.</p>

<p>Purified Polyclonal OTF3 antibody</p>

<p>The NT5C1A antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the NT5C1A protein, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving anti-HER2 antibody, monoclonal antibodies, growth factors, and reaction solutions. Furthermore, it has been shown to have antiangiogenic properties and can inhibit the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Additionally, the NT5C1A antibody has been found to be effective in blocking the activation of cardiomyocytes and autoantibodies involved in certain diseases. With its high specificity and reliability, this antibody is an invaluable tool for researchers studying cellular signaling pathways and developing therapeutic interventions.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>Rabbit Polyclonal ELOVL5 antibody</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The TRIM24 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the growth hormone receptor and has been shown to inhibit the activity of this receptor. The TRIM24 antibody is commonly used in studies investigating the role of growth factors, such as trastuzumab, and their interaction with receptors. Additionally, it has been used to study the function of phosphatases and their involvement in cellular signaling pathways. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and sensitivity, the TRIM24 antibody is an invaluable tool for researchers studying cell growth and signaling processes.</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>Sheep polyclonal Ritodrine antibody</p>

<p>The NEU2 antibody is a highly specialized monoclonal antibody that has a range of unique characteristics. It exhibits colloidal properties, making it an excellent choice for various applications. This antibody has been proven to have antiviral properties and can effectively neutralize the activity of specific viruses. Additionally, the NEU2 antibody is capable of binding to autoantibodies, providing potential therapeutic benefits in autoimmune disorders.</p>

<p>Mouse monoclonal MTFMT antibody</p>

<p>HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFM2 antibody, catalog no. 70R-10104</p>

<p>1-181 amino acids: MGSSHHHHHH SSGLVPRGSH MESKEPQLKG IVTRLFSQQG YFLQMHPDGT IDGTKDENSD YTLFNLIPVG LRVVAIQGVK ASLYVAMNGE GYLYSSDVFT PECKFKESVF ENYYVIYSST LYRQQESGRA WFLGLNKEGQ IMKGNRVKKT KPSSHFVPKP IEVCMYREQS LHEIGEKQGR SRKSSGTPTM NGGKVVNQDS T</p>

<p>The CD10 antibody is a monoclonal antibody that targets the CD10 protein, which is also known as neutral endopeptidase. This protein plays a crucial role in the degradation of extracellular matrix components such as collagen and acts as a kinase inhibitor. The CD10 antibody has been widely used in Life Sciences research to study various biological processes.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The SYNCRIP antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody has been extensively tested and shown to be effective in detecting SYNCRIP proteins in human serum samples.</p>

<p>MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK</p>

<p>REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI</p>

<p>The GPR87 antibody is a highly effective polyclonal antibody that specifically targets G-protein coupled receptor 87 (GPR87). This antibody has the ability to neutralize the activity of GPR87, which is known to play a crucial role in various cellular processes. It has been shown to inhibit the epidermal growth factor (EGF) signaling pathway, making it an excellent candidate for therapeutic applications in cancer treatment. Additionally, this antibody has shown promising results as a potential anti-HER2 antibody, further highlighting its versatility and effectiveness. With its ability to bind to interferon-gamma (IFN-gamma) and other growth factors, the GPR87 antibody offers a wide range of applications in the field of life sciences. Whether used as a research tool or for therapeutic purposes, this antibody is a valuable asset for scientists and researchers alike.</p>

<p>Purified Rabbit polyclonal MRPL50 antibody</p>

<p>N-[3-[(2R,3R)-5-Amino-3,6-dihydro-3-methyl-2-(trifluoromethyl)-2H-1,4-oxazin-3-yl]-4-fluorophenyl]-5-cyano-2-pyridinecarboxamide is a high purity chemical compound that is used in research. CAS No. 1352416-78-4 is an antibody that binds to the receptor of the ion channels and can be used as a research tool. The ligand is an inhibitor or activator of the protein interactions. This reagent has been shown to be useful for the study of cell biology and pharmacology.</p>

<p>OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV</p>

<p>Rabbit polyclonal USP34 antibody</p>

<p>RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN1 antibody, catalog no. 70R-7160</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal SPG7 antibody</p>

<p>Rabbit polyclonal LATS2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>VSV-G antibody was raised in goat using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.</p>

<p>Purified Polyclonal cJun antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, thus stopping the spread of the infection. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations in the body, ensuring its effectiveness against the bacteria.</p>

<p>MRPS22 antibody was raised in Rabbit using Human MRPS22 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK5 antibody, catalog no. 70R-5224</p>

<p>FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ</p>

<p>Purified recombinant STEAP4 protein (His tag)</p>

<p>UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK</p>

<p>Purified Polyclonal FOXC1/2 antibody</p>

<p>The IGJ antibody is a monoclonal antibody that specifically targets insulin in the human body. It is designed to bind to insulin molecules and prevent their interaction with insulin receptors, thereby inhibiting their activity. This antibody is commonly used in Life Sciences research to study the role of insulin in various physiological processes.</p>

<p>The Septin 9 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It has been extensively studied in the field of pluripotent stem cells and has shown promising results in various applications. This antibody has been used in research studies involving the treatment of cancer with doxorubicin, as well as in polymerase chain reactions (PCR) to detect specific messenger RNA molecules.</p>

<p>Rabbit polyclonal WDR4 antibody</p>

<p>Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.</p>

<p>KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL</p>

<p>PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>Rabbit Polyclonal MSK1 antibody (Thr581)</p>

<p>The PEX5 antibody is a monoclonal antibody that targets fibronectin, a growth factor involved in various cellular processes. This antibody specifically binds to PEX5, a protein involved in peroxisome biogenesis and function. It has been shown to inhibit endothelial cell growth and proliferation, making it a potential therapeutic option for diseases characterized by abnormal blood vessel formation. Additionally, the PEX5 antibody has demonstrated efficacy as a multidrug combination therapy when used in conjunction with other targeted therapies, such as epidermal growth factor inhibitors or anti-HER2 antibodies like trastuzumab. Its ability to modulate signaling pathways involving β-catenin and VEGF-C further highlights its potential applications in life sciences research. With its high specificity and affinity for its target, the PEX5 antibody offers valuable insights into peroxisome biology and holds promise for future therapeutic interventions.</p>

<p>RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS</p>

<p>Bedaquiline is a medicinal compound that acts as an inhibitor of protein kinases. It has been used as an anticancer agent due to its ability to inhibit the growth and proliferation of cancer cells. Bedaquiline works by binding to the ATP-binding site of kinases, thereby inhibiting their activity and leading to apoptosis in cancer cells. This compound has shown promise in treating Chinese hamster ovary (CHO) cells, which are commonly used in research for cancer therapies. Additionally, Bedaquiline has been found to be effective against urinary tract infections caused by certain bacteria by targeting the bacterial ATP synthase enzyme. This analog is a potent inhibitor of tumor growth and may have potential for the treatment of various types of cancers.</p>

<p>CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen</p>

<p>CD127 antibody is a polyclonal antibody that targets the TGF-beta protein. It is commonly used in life sciences research to study collagen and other related proteins. This antibody can be used in various applications, such as polymerase chain reaction (PCR), hybridization, and cytotoxic assays. CD127 antibody specifically binds to TGF-beta1 and can be used to detect its presence in samples. Additionally, this antibody has been shown to have an inhibitory effect on lectins, which are glycan-binding proteins. CD127 antibody is also known to promote the growth of human hepatocytes and exhibit natriuretic properties. Overall, this versatile antibody is a valuable tool for researchers studying TGF-beta signaling pathways and related biological processes.</p>

<p>Rabbit polyclonal SGCG antibody</p>

<p>The HIV1 gp41 protein is a key component of the human immunodeficiency virus (HIV-1) and plays a crucial role in viral entry into host cells. It is targeted by trastuzumab, an antibody used in the treatment of certain types of cancer. The protein interacts with cell surface receptors and co-receptors to mediate fusion between the viral envelope and the host cell membrane.</p>

<p>Mouse monoclonal CST2 antibody</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>AU1 tag antibody was raised in rabbit using AU1 (DTYRYI) conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal HAGHL antibody</p>

<p>The CD69 antibody is a monoclonal antibody that specifically targets the CD69 antigen. CD69 is a cell surface protein that is expressed on activated immune cells, such as T cells and natural killer cells. This antibody can be used in various research applications in the field of Life Sciences to study immune cell activation and function. It has been shown to inhibit hemolysis caused by mycoplasma genitalium infection and can be used as an inhibitor in related studies. The CD69 antibody is also used for the production of human monoclonal antibodies, which are important tools for studying hormone peptides, steroids, and other molecules involved in immune responses. Its unique ability to bind to CD69 dimers makes it a valuable tool for detecting autoantibodies or studying adipose tissue biology.</p>

<p>Purified Polyclonal ATF7 antibody</p>

<p>Halofuginone 5 Conjugate for use in immunoassays</p>

<p>LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS</p>

<p>CD56 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CD56 antigen, which is expressed on various cell types, including natural killer cells and neural tissues. This antibody is commonly used in studies involving growth factors such as GM-CSF and TGF-β1, as well as colony-stimulating factors. CD56 antibody has been shown to have high affinity and specificity for its target antigen, making it a valuable tool for detecting and analyzing CD56-expressing cells in samples such as human serum or tissue sections. Its binding mechanism involves disulfide bonds, ensuring stable and reliable results. Additionally, this antibody can be utilized in techniques such as immunohistochemistry or flow cytometry to investigate the role of CD56 in various biological processes.</p>

<p>ZNF524 antibody was raised in rabbit using the N terminal of ZNF524 as the immunogen</p>

<p>Rabbit polyclonal UBD antibody</p>

<p>Wdr8 antibody was raised in rabbit using the N terminal of Wdr8 as the immunogen</p>

<p>Rabbit polyclonal TSC22D3 antibody</p>