Produits biochimiques et réactifs

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Lambda ELISA Kit</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>Human KIM-1 ELISA Kit</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA kit for the detection of cAMP in the research laboratory</p>

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>

<p>Purified recombinant LGALS1 protein (His tag)</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Horse SAA ELISA Kit</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>

<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>

<p>Bovine SAA ELISA Kit</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig IgM ELISA Kit</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>Quantify dog hemoglobin in your samples.</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig IgM ELISA Kit</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Rabbit IgM ELISA Kit</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Quantify pig albumin in your samples.</p>

<p>Recombinant Human ARFIP1 protein</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>ELISA kit for detection of IGF2 in the research laboratory</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>