Produits biochimiques et réactifs

<p>Mouse monoclonal CORO1B antibody</p>

<p>Purified recombinant RPL22 protein (His tag)</p>

<p>The HAMA Blocking Reagent is a reactive compound commonly used in Life Sciences research. It is designed to block the interference caused by Human Anti-Mouse Antibodies (HAMA) in various assays and experiments.</p>

<p>Rabbit polyclonal ARF4 antibody</p>

<p>ZNF778 antibody was raised in rabbit using the N terminal of ZNF778 as the immunogen</p>

<p>Purified Rabbit polyclonal INSP3 antibody (Ser1598/1588)</p>

<p>Rabbit polyclonal AIRE antibody</p>

<p>GRO beta antibody was raised in rabbit using highly pure recombinant rat GRObeta/MIP-2 as the immunogen.</p>

<p>Rabbit polyclonal TBC1D5 antibody</p>

<p>The PAK2 antibody is a monoclonal antibody that specifically targets the insulin receptor, a nuclear receptor that plays a crucial role in regulating growth factors and insulin signaling pathways. This antibody binds to the insulin receptor and inhibits its activity, thereby modulating the response to insulin. The PAK2 antibody has been extensively studied in various life sciences research applications, including studies on dopamine signaling, protein synthesis, thymidylate synthesis, and epidermal growth factor signaling. Additionally, this antibody has shown potential therapeutic value in targeting specific proteins such as anti-HER2 antibodies and autoantibodies found in human serum. With its high specificity and versatility, the PAK2 antibody is an invaluable tool for researchers in the field of molecular biology and immunology.</p>

<p>The mGLUR5 antibody is a monoclonal antibody that specifically targets and binds to the metabotropic glutamate receptor 5 (mGLUR5). This antibody is widely used in research and diagnostic applications to study the function and expression of mGLUR5. It has been shown to be effective in detecting autoantibodies in human serum, including anti-thyroglobulin antibodies. The mGLUR5 antibody also exhibits high affinity for sorafenib, a growth factor receptor inhibitor, and demonstrates strong binding to serum albumin due to its reactive disulfide bond and cationic properties. Additionally, this specific antibody has been successfully used in studies involving phosphatase activity.</p>

<p>PPAR gamma antibody is a specific antibody that targets the peroxisome proliferator-activated receptor gamma (PPAR gamma). This antibody is widely used in Life Sciences research to study the functions and signaling pathways of PPAR gamma. PPAR gamma plays a crucial role in regulating gene expression involved in adipogenesis, insulin sensitivity, lipid metabolism, and inflammation. The PPAR gamma antibody has been shown to inhibit IL-17A-induced growth factor secretion in granulosa cells and promote the expression of E-cadherin. It can also be used for immunohistochemistry and immunofluorescence experiments to detect PPAR gamma expression levels in various tissues and cell types. This monoclonal antibody offers high specificity and sensitivity, making it an essential tool for researchers studying PPAR gamma-related diseases such as obesity, diabetes, and cancer.</p>

<p>Rabbit polyclonal MCM4 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>DEDD2 antibody was raised in rabbit using residues 144-129 of the DEDD2 protein as the immunogen.</p>

<p>CAMK4 antibody was raised in Rabbit using Human CAMK4 as the immunogen</p>

<p>Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>ASAP3 antibody was raised using the N terminal of ASAP3 corresponding to a region with amino acids RGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLG</p>

<p>The TP53 antibody is a growth factor that acts as a functional sweetener. It belongs to the class of antibodies and specifically targets the TP53 protein, which plays a crucial role in regulating cell division and preventing tumor formation. This monoclonal antibody has been extensively studied and shown to have neutralizing effects on the TP53 protein, thereby inhibiting its activity and promoting cell growth. It is widely used in life sciences research, particularly in studies related to cancer biology and immunology. The TP53 antibody has also been investigated for its potential therapeutic applications, including as a targeted treatment for certain types of cancer. Overall, this molecule drug shows great promise in advancing our understanding of cellular processes and developing novel therapies.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is an anticancer drug that acts as a kinase inhibitor. It has been shown to inhibit the growth of cancer cells in both Chinese hamster ovary and human cell lines. This analog has been found to induce apoptosis, or programmed cell death, in tumor cells. It is primarily excreted in urine and has demonstrated potent inhibitory activity against multiple kinases, including protein kinases A, B, and C. 4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is also known as nintedanib and is currently used as an inhibitor for the treatment of idiopathic pulmonary fibrosis</p>

<p>The Vimentin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets vimentin, a protein that forms intermediate filaments and plays a crucial role in maintaining cell structure and integrity. This antibody can be used to study various cellular processes such as cell migration, adhesion, and differentiation. Additionally, it has been shown to be effective in detecting vimentin expression in different cell types and tissues. The Vimentin antibody is also commonly used in immunohistochemistry and Western blotting experiments. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying vimentin-related pathways and diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB23 antibody, catalog no. 70R-5787</p>

<p>CD5 antibody (PE) was raised in mouse using human CD5 as the immunogen.</p>

<p>The SOCS3 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is specifically designed to target and bind to the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.</p>

<p>SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN</p>

<p>ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>CMV protein is a neutralizing agent that targets the telomerase enzyme in human cells. It can be used to produce antibodies that neutralize the activity of telomerase, which is often associated with cancer cells. CMV protein is commonly used in research and diagnostic laboratories within the Life Sciences field. It can also be used as a growth factor in cell culture media to promote cell proliferation and survival. Additionally, CMV protein has been found to interact with tyrosine residues on cell surface receptors, leading to the activation of signaling pathways involved in cellular processes such as proliferation and differentiation. This recombinant protein complex may have therapeutic potential in regenerative medicine or tissue engineering applications. Furthermore, CMV protein has been shown to bind to other proteins such as epidermal growth factor and collagen, suggesting its involvement in various biological processes. Its unique properties make it a valuable tool for studying cellular mechanisms and developing novel therapeutic strategies.</p>

<p>PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD</p>

<p>TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW</p>

<p>Rabbit polyclonal APC antibody (Ser2054)</p>

<p>The SUZ12 antibody is a highly effective antiviral agent that belongs to the class of inhibitors in Life Sciences. It has been extensively studied for its ability to target specific growth factors and human serum components, making it a valuable tool in the field of virology. This low-molecular-weight antibody has shown promising results in treating thrombocytopenia, a condition characterized by low platelet count. Additionally, it has been found to possess neutralizing properties against influenza hemagglutinin, making it an ideal candidate for developing antiviral therapies. The SUZ12 antibody can be immobilized on electrodes for use in various applications, and its high specificity makes it an excellent choice for monoclonal antibody-based diagnostics and research.</p>

<p>PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL</p>

<p>AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP</p>

<p>The NGAL antibody is a specific antibody that targets the epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α). It falls under the category of Life Sciences and Monoclonal Antibodies. This antibody has been shown to have neutralizing effects on autoantibodies and growth factors such as collagen, transforming growth factor-beta (TGF-beta), and fibronectin. By targeting these factors, the NGAL antibody can help regulate cell signaling pathways and inhibit abnormal cell growth. Additionally, this antibody has been found to be effective in blocking the activation of chemokines, which play a crucial role in inflammation and immune response. With its high specificity and neutralizing properties, the NGAL antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>

<p>GnRHR antibody was raised in mouse using highly pure human gonadotropin releasing hormone receptor as the immunogen.</p>

<p>Purified Polyclonal PPAR gamma antibody</p>

<p>PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE</p>

<p>The KRT8 antibody is a highly specialized monoclonal antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter with cholinergic properties. The KRT8 antibody has been extensively tested and validated for its specificity and sensitivity in detecting choline acetyltransferase in human serum samples.</p>

<p>The NGAL antibody is a monoclonal antibody that is commonly used in scientific research and medical diagnostics. It is designed to specifically bind to neutrophil gelatinase-associated lipocalin (NGAL), an anti-apoptotic protein that is involved in various physiological processes.</p>

<p>Purified Polyclonal COL4A1 antibody</p>

<p>The Cytokeratin 18 antibody is a highly activated monoclonal antibody that specifically targets cytokeratin 18, a protein found in human serum. This antibody is cationic in nature and has been extensively studied for its ability to bind to cytokeratin 18 and induce cytotoxic effects. It has been used in various research applications, including immunohistochemistry and western blotting, to detect the presence of cytokeratin 18 in different tissues and cell types.</p>

<p>BRDT antibody was raised in rabbit using the N terminal of BRDT as the immunogen</p>

<p>Purified Polyclonal ABHD12B antibody</p>

<p>Mouse monoclonal Reticulon 1A antibody</p>

<p>HUS1B antibody was raised in Rabbit using Human HUS1B as the immunogen</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>Recombinant Human TFRC protein (His tag)</p>

<p>The NGAL antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important biomarker for various diseases, including helicobacter infection and kidney injury. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA. Its high specificity and affinity make it an ideal choice for researchers studying the role of NGAL in disease progression and therapeutic interventions. With its ability to bind to NGAL with high precision, this antibody opens up new possibilities for understanding the complex mechanisms underlying chemokine signaling and endothelial growth factor regulation. Whether you are working in academia or industry, the NGAL antibody will undoubtedly enhance your research capabilities and contribute to advancements in the field.</p>

<p>DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ</p>

<p>The RBBP7 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor and has been extensively used in various applications such as immunoassays, immunofluorescence, and Western blotting. This antibody has shown high affinity and specificity for its target, making it an essential tool for studying cellular processes involving the epidermal growth factor pathway.</p>

<p>Mouse monoclonal LCMT1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TREML2 antibody, catalog no. 70R-6395</p>

<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>

<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>

<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Purified recombinant GNRH1 protein (His tag)</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant CSF2RA protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>

<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>

<p>HNRNPR antibody was raised in Rabbit using Human HNRNPR as the immunogen</p>

<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Rabbit polyclonal TMC1 antibody</p>

<p>Mouse monoclonal PDXK antibody</p>

<p>TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP</p>

<p>VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN</p>