Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C172H276N52O54S3Masse moléculaire :4,032.63 g/mol(Pyr 11)-Amyloid b-Protein (11-40)
CAS :Please enquire for more information about (Pyr 11)-Amyloid b-Protein (11-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C143H226N38O39SDegré de pureté :Min. 95%Masse moléculaire :3,133.62 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formule :C44H62N10O10S2Masse moléculaire :955.17 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Formule :C219H351N69O66S3Masse moléculaire :5,102.84 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formule :C67H118N26O17Masse moléculaire :1,559.85 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C32H48N8O14Masse moléculaire :768.78 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formule :C23H40N6O10Masse moléculaire :560.61 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/molACY-775
CAS :ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.
Formule :C17H19FN4O2Degré de pureté :Min. 95%Masse moléculaire :330.36 g/molH-Ala-Abu-OH
CAS :Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H14N2O3Degré de pureté :Min. 90%Couleur et forme :PowderMasse moléculaire :174.2 g/molbeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formule :C149H224N44O45SMasse moléculaire :3,383.78 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formule :C52H84N14O21Masse moléculaire :1,241.33 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molIGF-II (33-40)
CAS :This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.Formule :C38H74N20O12Degré de pureté :Min. 95%Masse moléculaire :1,003.12 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molPF 05175157
CAS :PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.
Formule :C23H27N5O2Degré de pureté :Min. 95%Masse moléculaire :405.49 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formule :C131H211N43O38Masse moléculaire :2,996.41 g/molS-Sulfo-L-cysteine sodium
CAS :S-sulfo-L-cysteine sodium is a high purity antibody that can be used as a research tool. It has been shown to interact with ion channels and protein interactions. S-sulfo-L-cysteine sodium is also used in the study of cell biology, pharmacology, and receptor binding. This substance is a ligand that activates or inhibits certain receptors, specifically peptides and ion channels. The CAS number for this molecule is 7381-67-1.
Formule :C3H6NNaO5S2Degré de pureté :Min. 95%Masse moléculaire :223.2 g/molRef: 3D-HAA38167
Produit arrêté[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formule :C35H56N8O9SMasse moléculaire :765 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molBudralazine
CAS :Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.
Formule :C14H16N4Degré de pureté :Min. 95%Masse moléculaire :240.3 g/molγ-Bag Cell Peptide
Catalogue peptide; min. 95% purity
Formule :C31H51N11O8Masse moléculaire :705.82 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formule :C64H99N19O17Masse moléculaire :1,406.62 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molALX-1393
CAS :ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.
Formule :C23H22FNO4Degré de pureté :Min. 95%Masse moléculaire :395.4 g/molSteroid Free Serum
Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.
Degré de pureté :Min. 95%hCG protein
The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes
Degré de pureté :Min. 95%Thymopentin acetate salt
CAS :Produit contrôléThymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.Formule :C30H49N9O9Degré de pureté :Min. 95%Masse moléculaire :679.77 g/molRef: 3D-FT109621
Produit arrêté8-(3-Chlorostyryl)caffeine
CAS :Produit contrôlé8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.
Formule :C16H15ClN4O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :330.77 g/molRef: 3D-XFA70011
Produit arrêtéCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
Cerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molOligopeptide-51
Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid
CAS :Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C15H11NO4Degré de pureté :Min. 95%Masse moléculaire :269.25 g/molRef: 3D-AAC27331
Produit arrêtéH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molSiratiazem
CAS :Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.
Formule :C24H30N2O4SDegré de pureté :Min. 95%Masse moléculaire :442.57 g/molBodipy cyclopamine
CAS :Fluorescent derivative of cyclopamine
Formule :C49H70BF2N5O4Degré de pureté :Min. 95%Couleur et forme :Red SolidMasse moléculaire :841.92 g/molDNL343
CAS :a brain-penetrating activator of eukaryotic initiation factor 2B (eIF2B) that inhibits the abnormal integrated stress response
Formule :C20H19ClF3N3O4Masse moléculaire :457.83 g/molL-MobileTrex
CAS :L-MobileTrex is an advanced analytical technology platform, which is a product of cutting-edge research in data science and computational modeling. This platform operates by integrating multi-dimensional datasets through sophisticated algorithms, providing enhanced data visualization and interpretability.
Formule :C23H23N5O5Degré de pureté :Min. 95%Masse moléculaire :449.46 g/molS 25585
CAS :S 25585 is a psychostimulant that has been shown to modulate the function of animals. It can be used in the treatment of cancer and autoimmune diseases, as well as to induce overfeeding in animals. S 25585 is an endogenous molecule with a cyclic structure. The affinity for binding of S 25585 to its receptor may depend on whether it is bound or unbound at the time of binding. This drug also has anti-cancer effects, which are due to its ability to inhibit uptake and stabilize cells that are not undergoing cell division. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside (Rifapentine) is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing
Formule :C22H23F3N4O6SDegré de pureté :Min. 95%Masse moléculaire :528.5 g/molCEA protein (Preservative-free)
Purified native Human CEA protein (Preservative-free)Degré de pureté :>95% By Sds-Page And ElectrophoresisCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/molMS67N
CAS :Please enquire for more information about MS67N including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C52H59F4N9O7SDegré de pureté :Min. 95%Masse moléculaire :1,030.14 g/mol1,2-Dipalmitoyl-3-dimethylammonium-propane
CAS :1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.
Formule :C37H73NO4Degré de pureté :Min. 95%Masse moléculaire :595.98 g/mol1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine
CAS :1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine is a broad spectrum antimicrobial that has been shown to have binding properties to peptides. This compound can be used as a potential antimicrobial for the treatment of bacterial infections and gramicidin, an antibiotic that is active against bacteria. It has also been shown to permeabilize cell membranes, which may lead to its function as an antimicrobial agent. 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine is water soluble and has been shown to have conformational properties. These conformational properties are responsible for its binding activity with peptides. 1POGPE is stable in both calorimetric assays and bilayers, which allows it to maintain its structure when interacting with other compounds. 1POGPE also has a high affinity forFormule :C39H76NO8PDegré de pureté :Min. 95%Masse moléculaire :718 g/molRef: 3D-BBA66294
Produit arrêtéL 162389
CAS :L 162389 is a synthetic, non-steroidal, anti-inflammatory drug (NSAID) that inhibits the enzyme cyclooxygenase. It inhibits the production of prostaglandins, which are known to cause pain and inflammation in the body. L 162389 is used for the treatment of inflammatory conditions such as rheumatoid arthritis and osteoarthritis.
Formule :C31H38N4O4SDegré de pureté :Min. 95%Masse moléculaire :562.7 g/molPigment red 48 (C.I. 15865)
CAS :Pigment Red 48 (C.I. 15865) is a red organic pigment that is soluble in water and most organic solvents. It has a melting point of 200°C and is used in paints, plastics, textiles, paper, and other products. Pigment Red 48 (C.I. 15865) can be synthesized by the diazonium salt coupling reaction between an aromatic amine and an acid chloride. The pigment also has a hydroxyl group that enables it to form covalent bonds with other molecules such as polymers or proteins. Pigment Red 48 (C.I. 15865) is used in many products because of its high stability, excellent heat resistance, low toxicity, non-irritating properties, high transparency, and good color fastness to light and washing.BR> Pigment Red 48 (C.I. 15865) is not considered hazardous according to the Globally Harmonized System of Classification and Lab
Formule :C18H11ClN2Na2O6SDegré de pureté :Min. 95%Masse moléculaire :464.79 g/molCB-1158
CAS :CB-1158 is an arginase inhibitor, which is a small molecule derived from a synthetic source designed to modulate immune functions. Its mode of action involves the inhibition of the arginase enzyme, a key player in the urea cycle responsible for the hydrolysis of arginine into ornithine and urea. By blocking arginase, CB-1158 effectively prevents the depletion of extracellular arginine, a vital amino acid required for the activation and proliferation of T cells within the immune system. This inhibition leads to enhanced immune responses against tumors.
Formule :C11H22BN3O5Degré de pureté :Min. 95%Masse moléculaire :287.12 g/molRef: 3D-VID73206
Produit arrêtéParainfluenza Virus Type 2 Antigen
Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.
There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.
Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.
Parainfluenza Virus Type 2 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-2 infection. It can also be used as a research tool in vaccine development.Degré de pureté :Min. 95%
