Produits biochimiques et réactifs

<p>The STX6 antibody is a highly reactive histidine-based growth factor that has been extensively studied in the field of Life Sciences. It is specifically designed to target and bind to mesothelin, a protein that is overexpressed in certain types of cancer cells. The STX6 antibody has shown promising results in inhibiting the growth and proliferation of cancer cells by blocking the interaction between mesothelin and its receptor.</p>

<p>Rabbit polyclonal NFAT3 antibody (Ser676)</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>Rabbit Polyclonal DNAL1 antibody</p>

<p>PR antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets glutamate and has monoclonal antibody properties. This antibody has been extensively studied for its role in regulating various biological processes, including the TGF-beta signaling pathway, collagen synthesis, and the modification of sugar moieties on proteins.</p>

<p>INPP5B antibody was raised in Rabbit using Human INPP5B as the immunogen</p>

<p>NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC</p>

<p>Penicillin antibody was raised in mouse using penicillin-BSA as the immunogen.</p>

<p>The USP7 antibody is a highly specialized biomolecule used in Life Sciences research. It is a monoclonal antibody that has been developed for chromatographic applications, specifically for the immobilization of collagen and other biomolecules. This antibody exhibits high affinity and specificity towards its target antigen, making it an excellent tool for various laboratory techniques.</p>

<p>MAPKAP1 antibody was raised in Rabbit using Human MAPKAP1 as the immunogen</p>

<p>MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD</p>

<p>Rabbit polyclonal SNAPC5 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>GP1BA antibody was raised in Rabbit using Human GP1BA as the immunogen</p>

<p>DISC1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that targets the DISC1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying DISC1 levels in human serum, albumin, lipoprotein lipase, and growth factor samples.</p>

<p>Rabbit polyclonal GR antibody (Ser203)</p>

<p>Rabbit polyclonal UCHL1 antibody (HRP)</p>

<p>The RBP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has antiviral properties and specifically targets the RBP1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of RBP1.</p>

<p>CIRBP antibody was raised using the middle region of CIRBP corresponding to a region with amino acids GYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHN</p>

<p>Rabbit polyclonal FOS antibody (Thr32)</p>

<p>Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE</p>

<p>Purified recombinant KLRC3 protein (His tag)</p>

<p>Armenian Hamster monoclonal IgG Isotype Control antibody (biotin)</p>

<p>HBsAg antibody was raised in rabbit using subtypes ad and ay of human HBsAg as the immunogen.</p>

<p>Purified recombinant NDUFS2 protein (His tag)</p>

<p>Dynamin 1 antibody was raised using the middle region of DNM1 corresponding to a region with amino acids PPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPA</p>

<p>SLC7A5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Lorazepam 3 Conjugate for use in immunoassays</p>

<p>Rat monoclonal RAE1g antibody (biotin)</p>

<p>HLX antibody was raised in Rabbit using Human HLX as the immunogen</p>

<p>AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL</p>

<p>BRAK antibody was raised in rabbit using highly pure recombinant human BRAK as the immunogen.</p>

<p>Chlamydophila pneumoniae Antigen is a native protein and antigen that is used for the detection of antibodies against C. pneumoniae. It is commonly used in life sciences research and microbiological culture studies. The antigen can be detected using immunofluorescence techniques, allowing for the identification and characterization of C. pneumoniae infections. This antigen does not cross-react with other bacterial antigens, such as Staphylococcus aureus, Mycobacterium, or Moraxella. Additionally, it has been shown to have neutralizing activity against amyloid-beta, which may have implications in the field of Alzheimer's disease research. By detecting this antigen, researchers can gain insights into the role of C. pneumoniae as an initiator or contributor to various diseases and conditions.</p>

<p>Rabbit polyclonal RFWD2 antibody</p>

<p>The OVOL1 antibody is a highly activated polyclonal antibody that specifically targets the chemokine OVOL1. This antibody has been extensively studied for its role in oxidative damage and its potential therapeutic applications. It has been shown to interact with various proteins, including erythropoietin, actin filaments, collagen, cationic peptides, superoxide, ketanserin, monoclonal antibodies, endothelial growth factors, androgen receptors, dopamine receptors, and E-cadherin. The OVOL1 antibody offers a promising avenue for further research into the mechanisms of oxidative damage and its potential treatment options.</p>

<p>Rabbit polyclonal SYNGAP1 antibody</p>

<p>ISYNA1 antibody was raised in Rabbit using Human ISYNA1 as the immunogen</p>

<p>CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF</p>

<p>CCRD6 antibody was raised in goat using a synthetic peptide C-L10ATEDADSENSSFYYYDYLDEVAFM35L corresponding to the N-terminal extracellular domain of human D6 as the immunogen.</p>

<p>CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL</p>

<p>LDLRAD3 antibody is a polyclonal antibody that is commonly used in life sciences research. It is highly specific and sensitive, making it an ideal tool for various applications. This antibody can be used for immunohistochemistry, Western blotting, ELISA, and other assays to detect the presence of LDLRAD3 protein in samples. The antibody has been validated using sodium citrate-activated antigen retrieval and has shown excellent performance in detecting LDLRAD3 in various tissues. Additionally, this antibody can be used as a primary or secondary antibody when combined with other antibodies to study protein-protein interactions or signaling pathways. Its high affinity and specificity make it a valuable tool for researchers studying growth factors, protein kinases, nuclear proteins, and inhibitors. With its versatility and reliability, the LDLRAD3 antibody is an essential component of any laboratory involved in life sciences research.</p>

<p>Rabbit polyclonal TOM1L1 antibody</p>

<p>TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF</p>

<p>The MYL6 antibody is a highly specific monoclonal antibody that targets the human serum. It is commonly used in assays and as an inhibitor in various research studies. This antibody specifically binds to collagen and hyaluronic acid, making it an excellent tool for studying these molecules and their interactions. Additionally, the MYL6 antibody has been shown to have cytotoxic effects on adipose tissue, making it a potential candidate for therapeutic applications. It can also be used in the detection of autoantibodies and as a tool to study urokinase plasminogen activator (uPA) signaling pathways. Furthermore, the MYL6 antibody has shown promising results as an anti-ICOS antibody, which could be beneficial in treating conditions related to thrombocytopenia. With its versatility and specificity, the MYL6 antibody is an invaluable tool for researchers in various fields of study.</p>

<p>The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications. It has been shown to be effective in neutralizing the activity of mesenchymal stem cells, making it a valuable tool for research and therapeutic purposes. Additionally, this antibody has demonstrated its ability to target and bind to specific proteins such as anti-mesothelin, fibrinogen, influenza hemagglutinin, and alpha-fetoprotein. This makes it an essential component in diagnostic tests and assays targeting these proteins. The ACY1 antibody has also shown potential antiviral properties, making it a promising candidate for the development of antiviral therapies. Its high specificity and affinity make it an invaluable tool for researchers and clinicians alike in their efforts to understand and combat various diseases and conditions.</p>

<p>Lp-PLA2 monoclonal antibody is a highly specialized antibody used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Lp-PLA2, an enzyme involved in the inflammation process. By binding to Lp-PLA2, this antibody helps to inhibit its activity, reducing inflammation levels in the body.</p>

<p>CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI</p>

<p>FHL2 antibody was raised in rabbit using the C terminal of FHL2 as the immunogen</p>

<p>Rabbit Polyclonal PSMA1 antibody (Ser250)</p>

<p>Rabbit polyclonal NFKB p105/p50 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC3 antibody, catalog no. 70R-4694</p>

<p>Purified Polyclonal Delta NaCH antibody</p>

<p>Purified Rabbit polyclonal OR5D3 antibody</p>

<p>PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC</p>

<p>KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH</p>

<p>SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS</p>

<p>The PMS2 antibody is a highly specific monoclonal antibody that binds to the PMS2 protein, an essential component of the DNA mismatch repair pathway. This antibody is widely used in life sciences research to study DNA repair mechanisms and identify genetic mutations associated with various diseases, including cancer. The PMS2 antibody has been shown to have high affinity and specificity for its target, making it an invaluable tool for immunohistochemistry, Western blotting, and other molecular biology techniques. Additionally, this antibody has been used to investigate the role of PMS2 in cellular processes such as transmembrane conductance and cytokine signaling pathways. With its reactive and activated properties, the PMS2 antibody is a valuable asset for researchers in the field of genetics and molecular biology.</p>

<p>CYP3A5 antibody was raised in rabbit using the N terminal of CYP3A5 as the immunogen</p>

<p>Rat Monoclonal EBNA2 antibody</p>

<p>Peptide H-EQLGEFYEALDCLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal C16orf72 antibody</p>

<p>Rabbit Polyclonal PDCD4 antibody (Ser67)</p>

<p>Rabbit polyclonal AKT1/2/3 antibody (Tyr315/316/312)</p>

<p>Purified Rabbit polyclonal ACOX1 antibody</p>

<p>The S100A8 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect and measure the levels of S100A8 protein in human serum samples. The antibody is immobilized on an electrode and reacts specifically with S100A8, allowing for accurate quantification. In addition to its use in diagnostics, the S100A8 antibody can also be used as a research tool. It can be used to study the role of S100A8 in various biological processes, such as inflammation and immune response. The antibody has neutralizing properties and can inhibit the activity of reactive oxygen species and interleukins. It is also being investigated as a potential therapeutic agent for conditions such as diuretic resistance and influenza hemagglutinin inhibition. With its versatility and specificity, the S100A8 antibody is a valuable tool for researchers in the life sciences field.</p>

<p>The MPG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively studied for its ability to detect estradiol levels in various biological samples. This antibody specifically targets and binds to the estradiol molecule, allowing for accurate measurement and analysis.</p>

<p>GOLGA3 antibody was raised in Rabbit using Human GOLGA3 as the immunogen</p>

<p>E. coli antibody was raised in mouse using a number of E. coli serotypes as the immunogen.</p>

<p>Rabbit polyclonal DOCK1 antibody</p>

<p>NCAPH antibody was raised using the C terminal of NCAPH corresponding to a region with amino acids TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG</p>

<p>Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.</p>

<p>Cardiac Troponin C Antigen</p>

<p>Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ</p>

<p>Rabbit Polyclonal GUSB antibody</p>

<p>Mouse monoclonal GRHPR antibody</p>

<p>Rabbit polyclonal BRCA1 antibody (Ser1423)</p>

<p>The CEA antibody is a monoclonal antibody that has neutralizing properties and acts as an inhibitor in various Life Sciences applications. It is commonly used in research and diagnostic settings to study the effects of different growth factors, such as TGF-beta and epidermal growth factor. This antibody specifically targets markers like collagen, c-myc, and alpha-fetoprotein, making it a valuable tool for studying their functions and interactions. With its high specificity and affinity, the CEA antibody provides accurate and reliable results in experiments related to cell signaling pathways, cancer research, and immunohistochemistry studies.</p>

<p>HDAC1 Monoclonal Antibody (FITC)</p>

<p>Purified Polyclonal CFC1B antibody</p>

<p>The ATG4D antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working in the area of antibodies and theranostics. This antibody specifically targets the proline-rich protein ATG4D, which plays a crucial role in autophagy, a cellular process involved in maintaining cellular homeostasis.</p>

<p>Goat anti human IgG (Fc) (Agarose Conjugated) was raised in goat using human IgG Fc fragment as the immunogen.</p>

<p>Rabbit polyclonal Collagen XX alpha 1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NPY1R antibody, catalog no. 70R-5940</p>

<p>The CTNNB1 antibody is a highly potent and effective agent used in the field of Life Sciences. This antibody has shown promising results in various applications, including as a serum marker for telomerase activity and interferon-stimulated gene expression. It has also been found to play a crucial role in pluripotent stem cell maintenance and differentiation. Additionally, the CTNNB1 antibody has demonstrated its efficacy as an anti-mesothelin agent, inhibiting the growth of cancer cells expressing this glycoprotein. Its mechanism of action involves targeting glycogen synthase kinase and interfering with key signaling pathways involved in cell proliferation and survival. With its high-flux binding capacity, this monoclonal antibody offers a reliable solution for researchers and clinicians seeking effective medicaments for their studies or therapeutic interventions.</p>

<p>The YPEL5 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the YPEL5 protein, a basic protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA</p>

<p>Purified Polyclonal AMPK beta 1 antibody</p>

<p>FES antibody was raised in Mouse using a purified recombinant fragment of FES expressed in E. coli as the immunogen.</p>

<p>IGF2BP2 antibody was raised using the middle region of IGF2BP2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS</p>

<p>The Synaptotagmin antibody is a diagnostic reagent used in Life Sciences. It is an antibody that specifically binds to the protein Synaptotagmin, which plays a crucial role in neurotransmitter release. This antibody can be used for various applications, including research on synaptic transmission and the study of neurological disorders. The Synaptotagmin antibody is produced using recombinant cells and has high specificity and sensitivity. It is a valuable tool for scientists and researchers working in the field of neuroscience. Additionally, this antibody can also be used as a medicament for therapeutic purposes, such as targeting specific proteins involved in diseases like botulinum poisoning or calpain-related disorders. With its wide range of applications, the Synaptotagmin antibody is an essential tool for any researcher or clinician working in the field of Life Sciences.</p>

<p>Rabbit polyclonal UBR1 antibody</p>

<p>Mouse monoclonal PDE4A antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 4) (His tag)</p>

<p>Rabbit polyclonal GPRIN2 antibody</p>

<p>CALM1 antibody was raised in Rabbit using Human CALM1 as the immunogen</p>

<p>JMJD6 antibody was raised in rabbit using the N terminal of JMJD6 as the immunogen</p>

<p>The GFAP antibody is a highly specialized tool used in Life Sciences research for insulin detection. It is a monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP), which is expressed in astrocytes, a type of brain cell. This antibody has been extensively validated and is widely used in various applications such as immunohistochemistry and Western blotting.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087</p>

<p>Mouse monoclonal TTC32 antibody</p>