Produits biochimiques et réactifs

<p>FASLG antibody was raised in rabbit using the middle region of FASLG as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHBDF1 antibody, catalog no. 70R-6632</p>

<p>UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids  TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK</p>

<p>GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH</p>

<p>MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF</p>

<p>MAP2K3 antibody was raised using the N terminal of MAP2K3 corresponding to a region with amino acids SKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEK</p>

<p>Stimulated human leukocytes</p>

<p>Goat anti-cat IgG (Alk Phos) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>RGS6 antibody was raised using the N terminal of RGS6 corresponding to a region with amino acids AQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A5 antibody, catalog no. 70R-8589</p>

<p>FUT8 antibody was raised in Rabbit using Human FUT8 as the immunogen</p>

<p>The SND1 antibody is a valuable tool in the field of Life Sciences. It specifically targets the cation channel and can be used as an inhibitor in various assays. The antibody works by binding to the cation, resulting in an antigen-antibody reaction that allows for further analysis and research.</p>

<p>Rabbit polyclonal Paxillin antibody (Tyr31)</p>

<p>Purified Polyclonal DNAJB11 antibody</p>

<p>TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI</p>

<p>The Shc1 antibody is a growth factor that belongs to the class of antibodies. It forms dimers and has neutralizing properties. This antibody binds to receptors, inhibiting the activity of Bace1, an enzyme involved in the production of amyloid beta peptides. By doing so, it reduces cytotoxicity and has potential therapeutic applications in neurodegenerative diseases such as Alzheimer's. The Shc1 antibody is available as both monoclonal and polyclonal antibodies. It has low density and can be used as an inhibitor in various life science research applications. Additionally, it has been found to have medicament properties and may play a role in hydroxyl formation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMG5 antibody, catalog no. 70R-4235</p>

<p>The CEBPB antibody is a highly specific antigen-antibody drug that targets actin, a protein involved in various cellular processes. This monoclonal antibody specifically binds to actin filaments in the nucleus, inhibiting their function and disrupting cellular activities. Additionally, this antibody has been shown to reduce microvessel density, indicating its potential as an anti-angiogenic agent.</p>

<p>GLT6D1 antibody was raised using the middle region of GLT6D1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM</p>

<p>Purified recombinant Human UBE2K protein</p>

<p>CFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE</p>

<p>The GBE1 antibody is a powerful biomarker used in the field of medicine. It belongs to the class of antibodies known as monoclonal antibodies, which are widely used in life sciences and cellular immunotherapy. This antibody specifically targets and binds to caveolin-1, a protein involved in various cellular processes. By inhibiting the activity of caveolin-1, the GBE1 antibody has shown promising results in reducing the progression of certain diseases. With its high specificity and potency, this antibody serves as an invaluable tool for researchers and clinicians alike in understanding and treating various conditions.</p>

<p>Rabbit polyclonal OR2D2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YARS antibody, catalog no. 70R-5037</p>

<p>The NUMB antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to the NUMB protein, which plays a crucial role in cell signaling and development. This antibody is widely used in various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified recombinant NAIF1 protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal TPRKB antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf65 antibody, catalog no. 70R-4265</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4816</p>

<p>Rabbit polyclonal RASSF9 antibody</p>

<p>Recombinant hnRNP C1+C2 Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZC3H14 antibody, catalog no. 70R-4409</p>

<p>HSV1/HSV2 antibody was raised in mouse using HSV 1 and 2 as the immunogen.</p>

<p>MAP1B antibody was raised in Rabbit using Human MAP1B as the immunogen</p>

<p>ADSS antibody was raised in Rabbit using Human ADSS as the immunogen</p>

<p>The MART1 antibody is a potent inhibitor that targets nuclear antigens in human serum. It specifically binds to the MART1 antigen, which is expressed in adipose tissue. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tyrosine kinase activity and epidermal growth factor receptor signaling. Additionally, it has been used as a tool for detecting c-myc expression and studying cell growth and differentiation. The MART1 antibody is available as a polyclonal antibody, making it a valuable tool for researchers in various fields.</p>

<p>GFP antibody was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>HADHB antibody is a monoclonal antibody that specifically targets collagen. It is designed to recognize and bind to the disulfide bonds present in collagen, which plays a crucial role in maintaining the structural integrity of tissues. This antibody has been shown to inhibit the activity of calpain, an enzyme involved in collagen degradation.</p>

<p>RAB2A antibody was raised in rabbit using the C terminal of RAB2A as the immunogen</p>

<p>Mouse monoclonal ICOS antibody (biotin)</p>

<p>Purified recombinant LIN7B protein</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>Purified Polyclonal PKC mu antibody</p>

<p>Rabbit polyclonal Ik31 antibody</p>

<p>Rabbit polyclonal B4GALT3 antibody (biotin)</p>

<p>TGF alpha antibody was raised in rabbit using highly pure recombinant human TGF-alpha as the immunogen.</p>

<p>Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.</p>

<p>Purified Mouse IgG (Fab'2)</p>

<p>MAP3K14 antibody was raised using the N terminal of MAP3K14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN</p>

<p>Rabbit polyclonal TR11B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf66 antibody, catalog no. 70R-8731</p>

<p>The HA antibody is a glycopeptide that specifically targets and binds to a glycoprotein called HA (Hemagglutinin). This colloidal solution contains Monoclonal Antibodies, which are highly specific antibodies produced by a single clone of cells. The HA antibody has neutralizing properties, meaning it can block the activity of the HA glycoprotein.</p>

<p>Akt, or Protein Kinase B (PKB), is a crucial signaling protein that regulates essential cellular functions, including growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, a key signaling pathway activated by growth factors and hormones like insulin to support cell survival and growth. Upon activation, Akt moves to the cell membrane, where it is phosphorylated by kinases such as PDK1, achieving full activation. Once active, Akt interacts with downstream pathways to prevent apoptosis, stimulate cell growth via the mTOR pathway, and boost glucose metabolism—vital for effective insulin response.In diseases like cancer and diabetes, Akt's role is especially important. Cancer often involves dysregulated Akt signaling due to mutations in pathway components like PI3K, PTEN, or Akt itself, leading to enhanced cell survival, unchecked growth, and treatment resistance. In diabetes, insulin resistance impairs Akt pathway function, reducing glucose uptake and resulting in high blood glucose levels. Given Akt's regulatory role in cell growth and metabolism, it is a primary focus in therapeutic research for conditions where its function is disrupted.</p>

<p>Sheep polyclonal Morphine 3 antibody</p>

<p>Rabbit polyclonal NFKB p105 antibody</p>

<p>Purified Rabbit polyclonal MPK11 antibody</p>

<p>Rabbit polyclonal GM2A antibody (biotin)</p>

<p>ALDH2 antibody was raised in Rabbit using Human ALDH2 as the immunogen</p>

<p>FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV</p>

<p>The Cathepsin B antibody is a highly effective monoclonal antibody that targets the cyclase-activating peptide (CAP). It is widely used in Life Sciences research to study various biological processes. This antibody has been shown to neutralize the activity of cathepsin B, an important enzyme involved in the degradation of fatty acids and collagen. The Cathepsin B antibody recognizes a conformational epitope on cathepsin B, making it highly specific for this target. In addition, this antibody can be used in combination with Polyclonal Antibodies to detect and quantify biomolecules in complex samples. The Cathepsin B antibody has also been found to have cytotoxic effects on certain cell types, making it a valuable tool for studying cell signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the Cathepsin B antibody is an essential tool for your studies.</p>

<p>The Myc antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor interleukin-6 (IL-6). IL-6 is known to play a crucial role in various biological processes, including cell proliferation and cytotoxicity. By specifically binding to IL-6, the Myc antibody effectively inhibits its activity, preventing excessive cell growth and promoting a balanced cellular environment.</p>

<p>The CD62E antibody is a monoclonal antibody that specifically targets the CD62E protein found on the surface of endothelial cells. This protein plays a crucial role in inflammation and immune response by mediating the adhesion of leukocytes to the endothelium. The CD62E antibody can be used in various applications in the field of Life Sciences, including research, diagnostics, and therapeutics.</p>

<p>Legionella pneumophila antibody (FITC) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX11 antibody, catalog no. 70R-10383</p>

<p>CRISPR/Cas9 Monoclonal Antibody BSA/Azide Free</p>

<p>NT4 antibody was raised in goat using highly pure recombinant human NT-4 as the immunogen.</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3L antibody, catalog no. 70R-3042</p>

<p>1-195 amino acids: MDCEVNNGSS LRDECITNLL VFGFLQSCSD NSFRRELDAL GHELPVLAPQ WEGYDELQTD GNRSSHSRLG RIEADSESQE DIIRNIARHL AQVGDSMDRS IPPGLVNGLA LQLRNTSRSE EDRNRDLATA LEQLLQAYPR DMEKEKTMLV LALLLAKKVA SHTPSLLRDV FHTTVNFINQ NLRTYVRSLA RNGMD</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL</p>

<p>The FAS antibody is a powerful tool in the field of biomedical research. It is an inhibitor that targets glycosylation, which is a crucial process for the modification of proteins. With its unique properties, this antibody can be used to study the effects of glycosylation on various biological processes.</p>

<p>The THC antibody is a low-density globulin that acts as a neutralizing agent against the effects of tetrahydrocannabinol (THC), the psychoactive compound found in cannabis. This monoclonal antibody specifically targets and binds to THC, preventing it from interacting with its receptor sites in the body. By doing so, it blocks the psychoactive effects of THC and provides a potential treatment option for individuals who have consumed cannabis and are experiencing unwanted side effects.</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>The SMN1 antibody is a highly specialized product used in the field of Life Sciences. It contains excipients, globulin, and low-density components that enhance its effectiveness. This antibody is produced using a unique process that involves the use of isothiocyanate and neutralizing agents to ensure its purity and potency.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC4172 antibody, catalog no. 70R-6992</p>

<p>Sheep polyclonal Pig Alanine Transaminase antibody</p>

<p>EVI2B antibody was raised using the middle region of EVI2B corresponding to a region with amino acids DICMDNIRENEISTKRTSIISLTPWKPSKSTLLADDLEIKLFESSENIED</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM62C antibody, catalog no. 70R-6915</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC87 antibody, catalog no. 70R-4369</p>

<p>KIAA1191 antibody was raised in Rabbit using Human KIAA1191 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG4L antibody, catalog no. 70R-4453</p>

<p>Alpha 2 Macroglobulin protein is a growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research as a Native Protein &amp; Antigen. This protein is found abundantly in human serum and has been extensively studied for its diverse functions.</p>

<p>ALDOB antibody was raised in Rabbit using Human ALDOB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPHN antibody, catalog no. 70R-2208</p>

<p>Purified Polyclonal Beta synuclein antibody</p>

<p>1-180 amino acids: MADSELQLVE QRIRSFPDFP TPGVVFRDIS PVLKDPASFR AAIGLLARHL KATHGGRIDY IAGLDSRGFL FGPSLAQELG LGCVLIRKRG KLPGPTLWAS YSLEYGKAEL EIQKDALEPG QRVVVVDDLL ATGGTMNAAC ELLGRLQAEV LECVSLVELT SLKGREKLAP VPFFSLLQYE</p>

<p>The Integrin alpha 6 antibody is a highly specialized serum marker that plays a crucial role in Life Sciences. This antibody specifically targets the extracellular domain of integrin alpha 6, which is involved in cell adhesion and migration. It is commonly used in research and diagnostic applications to identify and study integrin alpha 6 expression.</p>

<p>1-483 amino acids: MGSSHHHHHH SSGLVPRGSH MAQADIALIG LAVMGQNLIL NMNDHGFVVC AFNRTVSKVD DFLANEAKGT KVVGAQSLKE MVSKLKKPRR IILLVKAGQA VDDFIEKLVP LLDTGDIIID GGNSEYRDTT RRCRDLKAKG ILFVGSGVSG GEEGARYGPS LMPGGNKEAW PHIKTIFQGI AAKVGTGEPC CDWVGDEGAG HFVKMVHNGI EYGDMQLICE AYHLMKDVLG MAQDEMAQAF EDWNKTELDS FLIEITANIL KFQDTDGKHL LPKIRDSAGQ KGTGKWTAIS ALEYGVPVTL IGEAVFARCL SSLKDERIQA SKKLKGPQKF QFDGDKKSFL EDIRKALYAS KIISYAQGFM LLRQAATEFG WTLNYGGIAL MWRGGCIIRS VFLGKIKDAF DRNPELQNLL LDDFFKSAVE NCQDSWRRAV STGVQAGIPM PCFTTALSFY DGYRHEMLPA SLIQAQRDYF GAHTYELLAK PGQFIHTNWT GHGGTVSSSS YNA</p>

<p>CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK</p>

<p>Rabbit polyclonal Elk1 antibody (Ser389)</p>

<p>Rabbit polyclonal RASSF7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX3 antibody, catalog no. 70R-7415</p>

<p>The Giardia lamblia antibody is a highly specialized product used in Life Sciences research. This antibody specifically targets the circumsporozoite protein found in Giardia lamblia, an intestinal parasite that causes giardiasis. The antibody is designed to bind to this protein and neutralize its activity.</p>

<p>Rabbit polyclonal Mt12 antibody</p>

<p>Porcn antibody was raised in rabbit using the middle region of Porcn as the immunogen</p>

<p>Rabbit polyclonal COPS5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLU7 antibody, catalog no. 70R-4126</p>

<p>PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR</p>

<p>The HLADR antibody is a monoclonal antibody that is derived from human serum. It is specifically designed to target and bind to the HLADR protein, which plays a crucial role in immune response regulation. This antibody has been widely used in various applications within the Life Sciences field, such as immunoassays and research studies.</p>