Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.104 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.784 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.218 produits)
130576 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CEA antibody
<p>The CEA antibody is a highly activated and specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies, which are known for their targeted action against specific molecules. This particular antibody has a strong affinity towards chemokines, which are important signaling proteins involved in immune responses.</p>p27 antibody
<p>p27 antibody was raised in rabbit using a full length recombinant human p27 protein as the immunogen.</p>Degré de pureté :Min. 95%F10 antibody
<p>The F10 antibody is a highly specialized antibody that can be used for various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies. The F10 antibody has been shown to have neutralizing effects on alpha-fetoprotein, a protein associated with certain types of cancer. Additionally, it has been found to have inhibitory effects on colony-stimulating factors, which play a crucial role in the regulation of blood cell production.</p>MIP1 protein
<p>The MIP1 protein is a growth factor that belongs to the group of conjugated proteins. It plays a crucial role in various biological processes, including cell growth and development. The MIP1 protein acts as a signaling molecule, binding to specific receptors on the surface of target cells and triggering a cascade of cellular responses.</p>Degré de pureté :Min. 95%DNAJB1 antibody
<p>DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE</p>FGF21 antibody
<p>The FGF21 antibody is a highly specialized product used in the field of Life Sciences. It is an immobilized electrode that specifically targets and binds to the growth factor FGF21. This antibody has been extensively tested and proven to be effective in various applications, including the analysis of human serum biomolecules, collagen activation, chromatographic purification, and binding studies with chemokine and other growth factor binding proteins.</p>RGS11 antibody
<p>RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR</p>Degré de pureté :Min. 95%SLC15A3 antibody
<p>The SLC15A3 antibody is a highly versatile and effective tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SLC15A3 protein isoforms. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting.</p>Degré de pureté :Min. 95%Rat PMN antibody
<p>Rat PMN antibody was raised in rabbit using rat PMNs as the immunogen.</p>Degré de pureté :Min. 95%PDIA3 protein
<p>PDIA3 protein is a membrane-associated ubiquitin E3 ligase that plays a crucial role in various cellular processes. It is involved in the regulation of protein folding, assembly, and degradation. PDIA3 protein has been identified as a potential target for therapeutic intervention, and monoclonal antibodies against this protein have shown promising results as antagonist antibodies. These antibodies can inhibit the activity of PDIA3 and disrupt its function.</p>Degré de pureté :Min. 95%AChE antibody
<p>AChE antibody was raised in mouse using AChE from human erythrocytes as the immunogen.</p>Staphylococcus aureus antibody
<p>Staphylococcus aureus antibody was raised in rabbit using ATCC 27660 as the immunogen.</p>Degré de pureté :Min. 95%Epididymal secretory 4 monoclonal antibody
<p>Mouse anti-human epididymal secretory protein 4 monoclonal Antibody</p>SNRPE antibody
<p>The SNRPE antibody is a highly specialized monoclonal antibody that targets and neutralizes the fatty acid receptor SNRPE. This antibody is widely used in immunoassays and research within the Life Sciences field. It has been shown to have a high affinity for SNRPE, making it an effective tool for studying its role in various biological processes.</p>TAAR5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAAR5 antibody, catalog no. 70R-9832</p>Degré de pureté :Min. 95%DPP6 antibody
<p>DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT</p>Degré de pureté :Min. 95%GAPDH antibody
<p>The GAPDH antibody is a highly specialized monoclonal antibody that targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) protein. This cysteine-rich protein plays a crucial role in various cellular processes, including glycolysis and energy metabolism. Additionally, GAPDH has been identified as an angiogenic inducer and an activated growth factor.</p>PCNA antibody (Prediluted for IHC)
<p>Mouse monoclonal PCNA antibody (Prediluted for IHC)</p>Degré de pureté :Min. 95%TP53BP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53BP2 antibody, catalog no. 70R-8271</p>Degré de pureté :Min. 95%NR2E1 antibody
<p>NR2E1 antibody was raised using the middle region of NR2E1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL</p>Degré de pureté :Min. 95%MAOA antibody
<p>The MAOA antibody is a polyclonal antibody used in Life Sciences research and immunoassays. It specifically targets the monoamine oxidase A enzyme, which plays a crucial role in the metabolism of neurotransmitters such as serotonin, dopamine, and norepinephrine. This antibody is reactive and neutralizing, meaning it can bind to MAOA and inhibit its activity.</p>PRLHR antibody
<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Goat anti Human IgG (Alk Phos)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Degré de pureté :Min. 95%PSA antibody
<p>PSA antibody was raised in Mouse using a purified recombinant fragment of KLK3 (aa26-251) expressed in E. coli as the immunogen.</p>Androgen Receptor antibody
<p>The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect the androgen receptor, a protein that plays a crucial role in the regulation of epidermal growth factor signaling pathways. This antibody is produced using state-of-the-art techniques, ensuring high specificity and sensitivity.</p>GNA15 antibody
<p>GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG</p>Degré de pureté :Min. 95%FOXO4 antibody
<p>The FOXO4 antibody is a highly specialized protein that plays a crucial role in various biological processes. It specifically binds to FOXO4, a transcription factor involved in regulating gene expression. This antibody has been extensively studied and proven to be effective in immunoassays, making it an essential tool for researchers in the field of life sciences.</p>CEACAM7 protein (His tag)
<p>Purified recombinant CEACAM7 protein (His tag)</p>Degré de pureté :Min. 95%SLC35E2 antibody
<p>SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP</p>Degré de pureté :Min. 95%Troponin I antibody
<p>Troponin I antibody was raised in mouse using human troponin I as the immunogen.</p>GPR15 antibody
<p>GPR15 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%RHBDL2 antibody
<p>RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT</p>Degré de pureté :Min. 95%GAA antibody
<p>GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL</p>Degré de pureté :Min. 95%LY 309887
CAS :<p>LY 309887 is a synthetic analog of the natural compound LY315920. It has significant cytotoxicity in prostate cancer cells and leukemia cells. LY 309887 also inhibits cell growth in l1210 murine cells by blocking the ATP synthesis, which is required for cell division. It may also be effective against autoimmune diseases due to its ability to inhibit macrophage inflammatory activity and decrease tumor xenografts. The biochemical mechanism of action for LY 309887 is unknown at this time.</p>Formule :C19H23N5O6SDegré de pureté :Min. 95%Masse moléculaire :449.5 g/molTK2 protein (His tag)
<p>Purified recombinant Human TK2 protein (His tag)</p>Degré de pureté :Min. 95%TLR4 antibody
<p>The TLR4 antibody is a highly effective product in the field of Life Sciences. It is specifically designed to neutralize tumor necrosis factor-alpha (TNF-α) and has been extensively tested in human serum. This antibody also has the ability to inhibit the activity of transforming growth factor-beta (TGF-beta), alpha-fetoprotein, phalloidin, and creatine kinase. With its neutralizing properties, it effectively targets collagen and glycoprotein, making it an ideal choice for researchers working with actin filaments and electrodes. The TLR4 antibody is a polyclonal antibody that guarantees accurate and reliable results for your experiments.</p>CD105 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using the patch-clamp technique on human erythrocytes, confirming its high efficacy. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>Disarib
CAS :<p>Disarib is a potent inhibitor of protein kinases that has demonstrated anticancer activity in preclinical studies. It is an analog of the toxin disarcidin, which is isolated from the Chinese medicinal plant Hydractinia echinata. Disarib induces apoptosis in human cancer cells by inhibiting the activity of kinases involved in cell growth and survival pathways. This compound has also shown promising results as a tumor growth inhibitor in animal models. Disarib can be detected in urine samples after administration, which makes it a viable candidate for clinical development as an anticancer drug. Its unique mechanism of action and potent inhibition of kinases make it a promising option for future cancer therapies.</p>Formule :C26H16BrClN4OSDegré de pureté :Min. 95%Masse moléculaire :547.9 g/molMAP3K7IP1 antibody
<p>MAP3K7IP1 antibody was raised in Rabbit using Human MAP3K7IP1 as the immunogen</p>FANCA antibody
<p>The FANCA antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to target and bind to the FANCA protein, which is involved in various cellular processes such as insulin-like growth factor signaling and DNA repair. This antibody has been extensively studied and proven to be effective in research related to trastuzumab, alpha-synuclein, and other proteins.</p>Methyltestosterone antibody
<p>The Methyltestosterone antibody is a specific antibody used in various assays to detect and measure the presence of Methyltestosterone in human serum. It utilizes an agglutination assay principle, where the antigen-antibody reaction leads to the formation of visible clumps or aggregates. This antibody is derived from polyclonal antibodies, which are produced by immunizing animals with Methyltestosterone conjugated to a carrier protein.</p>Degré de pureté :Min. 95%Uromodulin antibody
<p>Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM</p>Degré de pureté :Min. 95%Synaptogyrin 2 antibody
<p>Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA</p>Degré de pureté :Min. 95%Cry1 antibody
<p>The Cry1 antibody is a monoclonal antibody that has neutralizing properties against the interferon-galectin-3-binding complex. This antibody specifically targets and binds to the Cry1 protein produced by Bacillus thuringiensis, inhibiting its endocytic uptake into cells. The Cry1 antibody also has a high affinity for fatty acids and collagen, making it an effective agent for blocking their interaction with target molecules. Additionally, this monoclonal antibody has been shown to inhibit phosphatase activity and reduce low-density lipoprotein (LDL) levels in vitro. With its versatile properties, the Cry1 antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>C20orf149 antibody
<p>C20orf149 antibody was raised in Rabbit using Human C20orf149 as the immunogen</p>ITPK1 antibody
<p>ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI</p>TOLLIP antibody
<p>TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG</p>Degré de pureté :Min. 95%SDF1 protein (Mouse) (His tag)
<p>Purified recombinant SDF1 protein (Mouse) (His tag)</p>Degré de pureté :Min. 95%CYTB antibody
<p>CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL</p>Degré de pureté :Min. 95%CPN60 antibody
<p>The CPN60 antibody is a highly specific monoclonal antibody that targets the α subunit of the CPN60 protein. This antibody is commonly used in hybridization studies to detect and visualize the presence of CPN60 in various samples. It can be used in combination with other antibodies, such as phalloidin, to study the localization and function of CPN60 within cells.</p>Pyk2 antibody
<p>The Pyk2 antibody is a powerful tool used in cytotoxic studies and immunohistochemistry. It specifically targets and binds to the Pyk2 protein, which plays a crucial role in cellular signaling pathways. By immobilizing the Pyk2 antibody, researchers can study its interactions with other binding proteins, such as transthyretin, chemokines, and interferons. This antibody is available in both polyclonal and monoclonal forms, providing versatility for different research needs. In the field of Life Sciences, the Pyk2 antibody is widely used for antibody-drug conjugate studies and as an antigen for CXCR4-related research. Its acidic properties make it suitable for various experimental techniques. With its high specificity and reliability, the Pyk2 antibody is an essential tool for scientists studying cellular signaling processes.</p>DAAM1 antibody
<p>DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV</p>PDAP1 antibody
<p>PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD</p>Zfy2 antibody
<p>Zfy2 antibody was raised in rabbit using the middle region of Zfy2 as the immunogen</p>Degré de pureté :Min. 95%CCDC69 antibody
<p>CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT</p>ERK1 antibody
<p>The ERK1 antibody is a highly specialized antibody that is used for the detection and analysis of activated ERK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity in various research applications. It is commonly used in studies involving ginseng, botulinum, histidine protein, and other related fields.</p>Degré de pureté :Min. 95%OR1S1 antibody
<p>OR1S1 antibody was raised in rabbit using the C terminal of OR1S1 as the immunogen</p>Degré de pureté :Min. 95%CD3 antibody
<p>CD3 antibody is a monoclonal antibody that targets the CD3 antigen on T cells. It is commonly used in research and clinical settings to study T cell function and activation. The CD3 antibody binds to the CD3 complex, which consists of multiple subunits including the CD3γ, δ, ε, and ζ chains. This binding activates T cells and initiates a cascade of signaling events that lead to T cell activation and proliferation.</p>SETDB2 antibody
<p>SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE</p>CCL2 antibody
<p>The CCL2 antibody is a powerful immunomodulatory agent that has cytotoxic properties. It belongs to the class of antibodies and is known for its reactive nature against cancer cells. In the field of Life Sciences, this antibody is widely recognized for its potential as an anticancer agent. It has been shown to be effective in inhibiting the growth and proliferation of cancer cells, particularly in HL-60 cell lines. The CCL2 antibody can also activate interferon and other growth factors, leading to enhanced immune response against cancer cells. Additionally, this antibody has antiviral properties and can neutralize binding proteins involved in viral infections. With its multidrug capabilities, the CCL2 antibody holds great promise in the field of cancer research and immunotherapy.</p>RPL4 antibody
<p>The RPL4 antibody is a protein that specifically targets and neutralizes collagen. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. This antibody has been shown to inhibit the activity of hepatocyte growth factor and epidermal growth factor, both of which play crucial roles in cell proliferation and tissue regeneration. The RPL4 antibody is available as both low-molecular-weight dimers and monoclonal antibodies, allowing for various applications in research and diagnostics. It can be immobilized using chromatographic techniques or activated for specific binding assays.</p>Carbamazepine antibody
<p>Carbamazepine antibody is a powerful tool used in immunoassays for the detection and quantification of carbamazepine, a commonly prescribed medication. This antibody specifically recognizes and binds to carbamazepine molecules, allowing for accurate measurement in various biological samples. It can be used to isolate nucleic acids or other target molecules that are associated with carbamazepine metabolism or response.</p>Degré de pureté :Min. 95%SARS-CoV-2 coronavirus nucleocapsid protein
<p>SARS-CoV-2 coronavirus nucleocapsid protein (N protein)</p>Degré de pureté :Min. 95%CSK antibody
<p>CSK antibody was raised in Mouse using a purified recombinant fragment of human CSK expressed in E. coli as the immunogen.</p>Attractin antibody
<p>Attractin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Goat anti Human IgE (ε chain) (HRP)
<p>Goat anti-Human IgE (epsilon chain) (HRP) was raised in goat using purified Human IgE as the immunogen.</p>SLC6A14 antibody
<p>SLC6A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW</p>Degré de pureté :Min. 95%CRSP7 antibody
<p>CRSP7 antibody was raised in mouse using recombinant Human Cofactor Required For Sp1 Transcriptional Activation, Subunit 7, 70Kda (Crsp7)</p>
