Produits biochimiques et réactifs

<p>The SYT13 antibody is an essential tool in Life Sciences research. It is an antibody that specifically targets and binds to SYT13, a glycoprotein involved in various cellular processes. This antibody has been extensively tested and characterized for its specificity, sensitivity, and neutralizing properties.</p>

<p>CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI</p>

<p>G-CSF is a glycoprotein that belongs to the cytokine family and is used as a medication. It stimulates the production of neutrophils, which are important in defending the body against infections. G-CSF also has a role in stimulating stem cell production and can be used to treat cancer patients undergoing chemotherapy. G-CSF binds to receptors on the surface of cells, activating intracellular signaling pathways. The binding of G-CSF to its receptor activates phospholipase C (PLC), which hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) into two second messengers: inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG). IP3 causes release of calcium from intracellular stores, leading to an increase in cytosolic free calcium concentration. DAG activates protein kinase C (PKC)</p>

<p>5-HT1B/1D serotonin receptor agonist; acute treatment for migraine</p>

<p>Rabbit polyclonal POLR3F antibody</p>

<p>Rabbit polyclonal TLP8 antibody</p>

<p>Arf4 antibody was raised in rabbit using the N terminal of Arf4 as the immunogen</p>

<p>GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR</p>

<p>The FGF21 antibody is a monoclonal antibody that specifically targets and binds to fibroblast growth factor 21 (FGF21). FGF21 is a growth factor that plays a crucial role in regulating various metabolic processes, including glucose and lipid metabolism. The FGF21 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to metabolic disorders.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-35F15.2 antibody, catalog no. 70R-6484</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SGCE antibody, catalog no. 70R-6701</p>

<p>Recombinant Human uGT1A1 protein (His tag)</p>

<p>Rabbit polyclonal U69 antibody</p>

<p>Purified Polyclonal PEX7 antibody</p>

<p>Rabbit polyclonal LAMA3 antibody</p>

<p>The Caspase 7 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This polyclonal antibody specifically targets caspase 7, an enzyme involved in programmed cell death (apoptosis). It is widely used in life sciences research to study the mechanisms of apoptosis and its regulation.</p>

<p>Mouse monoclonal ARFGAP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHLDA1 antibody, catalog no. 70R-2177</p>

<p>Rat monoclonal CD4 antibody (biotin); mouse target; IgG2b kappa; clone GK1.5</p>

<p>Rabbit polyclonal FKBP1A antibody (FITC)</p>

<p>SH3BP5 antibody was raised in rabbit using the N terminal of SH3BP5 as the immunogen</p>

<p>UBE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL</p>

<p>RLN1 antibody was raised in rabbit using the middle region of RLN1 as the immunogen</p>

<p>C4d Complement fragment Monoclonal Antibody (HRP)</p>

<p>Rabbit polyclonal OR4F4 antibody</p>

<p>The BAIAP2L2 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the β-catenin protein, which plays a crucial role in cell growth and development. This antibody can be used to study the interactions between β-catenin and other growth factors, such as alpha-synuclein and epidermal growth factor.</p>

<p>Purified Polyclonal PLC gamma 2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA4F antibody, catalog no. 70R-6853</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM135B antibody, catalog no. 70R-3897</p>

<p>SP1 antibody was raised in rabbit using the C terminal of SP1 as the immunogen</p>

<p>NSC 756093 is a synthetic compound that binds to the cytoskeletal protein tubulin, which is involved in cell division. NSC 756093 can inhibit the movement of the microtubule, leading to disruption of the mitotic spindle and arrest of cell division. This drug has been shown to be effective against resistant cancer cells and may be useful as a chemotherapeutic treatment for cancers such as leukemia or breast cancer.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KBTBD10 antibody, catalog no. 20R-1205</p>

<p>Rabbit polyclonal POLR1A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC17 antibody, catalog no. 70R-5970</p>

<p>Rabbit polyclonal Caper antibody</p>

<p>Rabbit polyclonal NDUFA8 antibody</p>

<p>Rabbit polyclonal IFNG antibody (biotin)</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>The Cytokeratin 16 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets cytokeratin 16, an intermediate filament protein found in various epithelial tissues. This antibody has been extensively studied and proven to be effective in detecting and quantifying cytokeratin 16 expression.</p>

<p>ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogen</p>

<p>The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.</p>

<p>HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKH antibody, catalog no. 70R-6654</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX23 antibody, catalog no. 70R-1383</p>

<p>Region of HVEM protein corresponding to amino acids LPSCKEDEYP VGSECCPKCS PGYRVKEACG ELTGTVCEPC PPGTYIAHLN GLSKCLQCQM CDPAMGLRAS RNCSRTENAV CGCSPGHFCI VQDGDHCAAC RAYATSSPGQ RVQKGGTESQ DTLCQNCPPG TFSPNGTLEE CQHQTKRSCD KTHTCPPCPA PELLGGPSVF LFPPKPKDTL MISRTPEVTC VVVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR VVSVLTVLHQ DWLNGKEYKC KVSNKALPAP IEKTISKAKG QPREPQVYTL PPSRDELTKN QVSLTCLVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLYSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK. Conjugated to Fc.</p>

<p>KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ</p>

<p>Rabbit polyclonal COL4A2 antibody (FITC)</p>

<p>Mouse monoclonal IL1b antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AQP10 antibody, catalog no. 70R-7451</p>

<p>MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NBL1 antibody, catalog no. 70R-5414</p>

<p>Rabbit polyclonal SMARCE1 antibody</p>

<p>TOP2A antibody was raised in rabbit using the C terminal of TOP2A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFT74 antibody, catalog no. 70R-10410</p>

<p>AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.</p>

<p>CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.</p>

<p>B4galt5 antibody was raised in rabbit using the C terminal of B4galt5 as the immunogen</p>

<p>A4GNT antibody was raised using the N terminal of A4GNT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME</p>

<p>KCNJ15 antibody was raised in Rabbit using Human KCNJ15 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RORC antibody, catalog no. 70R-2142</p>

<p>Rabbit polyclonal CYB5 antibody (FITC)</p>

<p>Rabbit polyclonal PRP31 antibody</p>

<p>1-160 amino acids: MTLEELVACD NAAQKMQTVT AAVEELLVAA QRQDRLTVGV YESAKLMNVD PDSVVLCLLA IDEEEEDDIA LQIHFTLIQS FCCDNDINIV RVSGMQRLAQ LLGEPAETQG TTEARDLHCL LVTNPHTDAW KSHGLVEVAS YCEESRGNNQ WVPYISLQER</p>

<p>Rabbit polyclonal USP12 antibody</p>

<p>GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH</p>

<p>RSV antibody was raised in mouse using fusion protein of RSV as the immunogen.</p>

<p>ATF2 antibody is a highly sought-after product in the field of Life Sciences. It is an essential tool for researchers studying antiphospholipid antibodies and their role in various biological processes. This monoclonal antibody specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.</p>

<p>Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide</p>

<p>Ceftazidime Pentahydrate (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal PEX1 antibody</p>

<p>Mouse monoclonal CD38 antibody (FITC)</p>

<p>GJB1 antibody was raised in Rabbit using Human GJB1 as the immunogen</p>

<p>Prolactin is a protein that is secreted by the anterior pituitary gland. It has many functions, including the stimulation of milk production and the regulation of other hormones. Prolactin Human contains purified human prolactin in a lyophilized powder form. It can be reconstituted with sterile water for injection or bacteriostatic water for injection for use in research or therapeutic applications.</p>

<p>Rabbit polyclonal ADRA1A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN10 antibody, catalog no. 70R-10385</p>

<p>Purified recombinant Mouse S100A3 protein (His tag)</p>

<p>CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV</p>

<p>ALDH6A1 antibody was raised in Rabbit using Human ALDH6A1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC16A1 antibody, catalog no. 70R-1756</p>

<p>Rabbit polyclonal Tau antibody (Ser422)</p>

<p>CD44 antibody (Azide free) was raised in rat using murine CD44/Pgp-1 as the immunogen.</p>

<p>MGC27016 antibody was raised using the N terminal of MGC27016 corresponding to a region with amino acids LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA4 antibody, catalog no. 70R-6164</p>

<p>PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE</p>

<p>TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM39 antibody, catalog no. 70R-4669</p>

<p>Purified Polyclonal AKAP13 antibody</p>

<p>The Toll-like receptor 4 antibody is a cytotoxic monoclonal antibody that targets the Toll-like receptor 4 (TLR4) protein. TLR4 plays a crucial role in the innate immune response by recognizing pathogen-associated molecular patterns (PAMPs) and initiating an inflammatory response. This antibody specifically binds to TLR4, inhibiting its activation and downstream signaling pathways.</p>

<p>Mouse monoclonal RPS6KB1 antibody</p>

<p>1-215 amino acids: MGSSHHHHHH SSGLVPRGSH MSSGAASGTG RGRPRGGGPG PGDPPPSETH KLVVVGGGGV GKSALTIQFI QSYFVSDYDP TIEDSYTKIC SVDGIPARLD ILDTAGQEEF GAMREQYMRA GHGFLLVFAI NDRQSFNEVG KLFTQILRVK DRDDFPVVLV GNKADLESQR QVPRSEASAF GASHHVAYFE ASAKLRLNVD EAFEQLVRAV RKYQEQELPP SPPSAPRKKG GGCPC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Cpa3 antibody, catalog no. 70R-8523</p>

<p>Recombinant Human SFRP5 protein (His tag)</p>

<p>The FKHR antibody is a potent inhibitor that is widely used in Life Sciences research. It is commonly employed in assays to study the function and activity of FKHR, a tyrosine family kinase inhibitor. This monoclonal antibody specifically targets FKHR and has been shown to effectively block its activity in various cell lines, including MCF-7 cells. Additionally, the FKHR antibody has been used in studies investigating the role of FKHR in steroid signaling pathways and dopamine release. It can also be utilized as a valuable tool for studying the interaction between FKHR and other proteins, such as fibrinogen. With its high specificity and affinity, this monoclonal antibody is a reliable choice for researchers looking to explore the functions of FKHR in different biological contexts.</p>

<p>Clostridium difficile Toxin A protein is a highly specific and potent toxin that plays a key role in the pathogenesis of Clostridium difficile infection. It is an acetyltransferase enzyme that modifies host cell proteins, leading to disruption of cellular processes and damage to the intestinal epithelium. This protein has been extensively studied and characterized, making it an important target for therapeutic interventions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL13 antibody, catalog no. 70R-1470</p>