Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf180 antibody, catalog no. 70R-6428</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMDEC1 antibody, catalog no. 70R-6062</p>

<p>ZNF161 antibody was raised in mouse using recombinant Human Vascular Endothelial Zinc Finger 1 (Vezf1)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN3 antibody, catalog no. 70R-7186</p>

<p>Alpha 1 Antitrypsin protein is a vital component in the field of Life Sciences. It plays a crucial role in inhibiting the activity of enzymes such as phosphatase and creatine kinase, which are involved in various cellular processes. This protein is extensively glycosylated and can be found in human serum and mesenchymal stem cells. The importance of Alpha 1 Antitrypsin protein lies in its ability to protect tissues from damage caused by proteases. It acts as a natural inhibitor of enzymes that break down proteins, preventing excessive tissue degradation. Additionally, it has been found to have immunomodulatory properties, suggesting its potential role in regulating immune responses. Researchers have also identified the significance of Alpha 1 Antitrypsin protein in various diseases. For example, it has been associated with hepatocyte growth factor activation and plays a crucial role in liver regeneration. Monoclonal antibodies targeting this protein have shown promising results in treating certain conditions. Furthermore</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DSC3 antibody, catalog no. 70R-6132</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>FSH alpha antibody was raised in mouse using purified human FSH alpha as the immunogen.</p>

<p>GRM6 antibody was raised in rabbit using the middle region of GRM6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADH4 antibody, catalog no. 70R-1191</p>

<p>Mouse monoclonal BTCL2 antibody</p>

<p>The Theophylline antibody is a polyclonal antibody that targets the growth factor and multidrug resistance protein known as Theophylline. This glycopeptide is involved in various biological processes, including epidermal growth factor signaling, collagen synthesis, and glycosylation. The Theophylline antibody has been extensively tested and validated for its specificity and sensitivity in detecting Theophylline in various samples. It can be used in immunoassays such as ELISA or Western blotting to quantify the levels of Theophylline or to study its interactions with other proteins or receptors. Researchers have also used this antibody to investigate the role of Theophylline in erythropoietin activation and signaling through the erythropoietin receptor. Additionally, monoclonal antibodies against Theophylline have been developed for therapeutic applications, such as targeting interleukin-6 or helicobacter infections. With its high affinity and selectivity, the Theophylline antibody</p>

<p>Platelet glycoprotein IIb/IIIa antibody was raised in sheep using purified glycoprotein IIb/IIIa complex (GPIIb/IIIa) prepared from platelets as the immunogen.</p>

<p>ARMCX1 antibody was raised using the C terminal of ARMCX1 corresponding to a region with amino acids DNIKNEGLASSRKEFSRSSLFFLFKESGVCVKKIKALANHNDLVVKVKVL</p>

<p>Rabbit polyclonal PPCS antibody</p>

<p>MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.</p>

<p>Rat monoclonal BP1 antibody (FITC)</p>

<p>Region of murine EGF protein corresponding to amino acids NSYPGCPSSY DGYCLNGGVC MHIESLDSYT CNCVIGYSGD RCQTRDLRWW ELR</p>

<p>The CREB1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the CREB1 protein, which plays a crucial role in various cellular processes. This antibody is produced through advanced techniques, ensuring high specificity and affinity.</p>

<p>The Cathepsin D antibody is a monoclonal antibody that specifically targets and neutralizes the activity of Cathepsin D, a protease enzyme found in human serum. This antibody has been developed for use in immunoassays and research applications focused on understanding the role of Cathepsin D in various biological processes.</p>

<p>Affinity purified Rabbit polyclonal I309 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM81A antibody, catalog no. 70R-4164</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OSTalpha antibody, catalog no. 70R-4593</p>

<p>The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.</p>

<p>The BCHE antibody is a highly specialized monoclonal antibody used in Life Sciences. It has antiviral properties and is specifically designed to target the mineralocorticoid receptor, a key regulator of sodium and potassium balance in the body. Additionally, this antibody acts as a growth factor, promoting insulin-like activity and stimulating cell proliferation.</p>

<p>Purified recombinant CD5 protein (His tag)</p>

<p>The PPARG antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to PPARG, a protein involved in various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.</p>

<p>Mouse monoclonal ALDOB antibody</p>

<p>Mouse monoclonal CD9 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VASP antibody, catalog no. 70R-10267</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF578 antibody, catalog no. 70R-8908</p>

<p>The UHRF1 antibody is a highly effective polyclonal antibody that specifically targets the UHRF1 protein molecule. This antibody has been extensively tested and proven to bind with high affinity to the target molecule, ensuring accurate and reliable results in various applications. It has been shown to effectively detect UHRF1 in human serum samples, making it an invaluable tool for researchers studying this protein. The UHRF1 antibody is also available as a monoclonal antibody, providing even greater specificity and sensitivity in detecting UHRF1. With its exceptional performance and versatility, this antibody is a must-have for scientists in the field of Life Sciences.</p>

<p>Eotaxin 3 antibody was raised in mouse using highly pure recombinant human eotaxin-3 as the immunogen.</p>

<p>The LOX antibody is a growth factor that belongs to the glycoprotein family. It is widely used in Life Sciences research for its ability to inhibit phosphatase activity. This monoclonal antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The LOX antibody specifically targets human serum and has been shown to interact with fibronectin, collagen, alpha-fetoprotein, dopamine, and other proteins. Its high specificity and affinity make it an excellent tool for studying the role of LOX in various biological processes. Whether you're investigating cancer development or tissue remodeling, the LOX antibody is a valuable asset in your research arsenal.</p>

<p>Rabbit polyclonal LRP3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4675</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1333 antibody, catalog no. 70R-3092</p>

<p>SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL</p>

<p>C21ORF18 antibody was raised in rabbit using the C terminal of C21ORF18 as the immunogen</p>

<p>Synthetic N-terminal human BCL10 immunogen; affinity purified Rabbit polyclonal BCL10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYT1 antibody, catalog no. 70R-9778</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM9 antibody, catalog no. 70R-7412</p>

<p>Purified Rabbit polyclonal MKK10-2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHGA antibody, catalog no. 70R-1565</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT21 antibody, catalog no. 70R-1446</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTF1 antibody, catalog no. 70R-5254</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCN3 antibody, catalog no. 70R-5456</p>

<p>Rabbit polyclonal AMBP antibody (FITC)</p>

<p>PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISIL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP10 antibody, catalog no. 70R-2076</p>

<p>Purified Polyclonal RFX3 antibody</p>

<p>Rabbit polyclonal RPS21 antibody</p>

<p>Rabbit polyclonal PPP1R1B antibody</p>

<p>PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS</p>

<p>The RAB5 antibody is a highly specific polyclonal antibody that targets the RAB5 protein. This protein plays a crucial role in the regulation of endocytic trafficking and is involved in various cellular processes such as receptor internalization, vesicle fusion, and intracellular signaling. The RAB5 antibody has been extensively validated for use in immunohistochemistry (IHC), immunofluorescence (IF), and western blotting (WB) applications.</p>

<p>The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.</p>

<p>Goat anti-dog IgG (H + L) (HRP) was raised in goat using canine IgG, whole molecule as the immunogen.</p>

<p>SLC5A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids  VGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCND3 antibody, catalog no. 70R-5186</p>

<p>The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.</p>

<p>Rabbit polyclonal EGFR antibody (Ser1071)</p>

<p>GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF</p>

<p>RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIFC3 antibody, catalog no. 70R-5600</p>

<p>Rabbit polyclonal CKMT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF428 antibody, catalog no. 70R-8460</p>

<p>ZNF543 antibody was raised in rabbit using the middle region of ZNF543 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6725</p>

<p>Purified Rabbit polyclonal MPK7 antibody</p>

<p>HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically Expressed</p>

<p>Mouse monoclonal SCYL3 antibody</p>

<p>The ARF6 antibody is a highly specialized monoclonal antibody that targets the protein ARF6. This protein plays a crucial role in various cellular processes, including interleukin-6 signaling and growth factor receptor trafficking. The ARF6 antibody specifically recognizes and binds to the histidine residue on ARF6, allowing for targeted inhibition of its function.</p>

<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>

<p>The BHMT antibody is a monoclonal antibody that specifically targets CD33, a receptor protein expressed on the surface of certain cells. This antibody is widely used in Life Sciences research and immunoassays to detect and study CD33-related processes. The BHMT antibody has a high affinity for CD33 due to its unique binding site, which allows for accurate and reliable detection. It can be used in various applications such as flow cytometry, immunohistochemistry, and Western blotting. Additionally, this antibody has been utilized in studies investigating collagen synthesis, disulfide bond formation, glucagon signaling, TNF-α inhibition, and the presence of autoantibodies. With its exceptional specificity and sensitivity, the BHMT antibody is an invaluable tool for researchers studying CD33-related pathways and diseases.</p>

<p>NARS antibody was raised in Rabbit using Human NARS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CREB3L1 antibody, catalog no. 20R-1233</p>

<p>Rabbit polyclonal TSEN2 antibody</p>

<p>Rabbit polyclonal SENP2 antibody</p>

<p>The DTNB antibody is a highly specialized product in the field of Life Sciences. It belongs to the group of chemokine antibodies and is widely used in various immunoassays. This antibody specifically targets a specific molecule and can be used for the detection and quantification of this target in samples.</p>

<p>Rabbit polyclonal GPI antibody (HRP)</p>

<p>Purified Polyclonal Profilin 2 antibody</p>

<p>EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1082</p>

<p>PDCD11 antibody was raised in mouse using recombinant Human Programmed Cell Death 11</p>

<p>The POT1 antibody is a polyclonal antibody that specifically targets brain natriuretic peptide (BNP). It belongs to the class of antibodies known as neutralizing antibodies and is widely used in life sciences research. The POT1 antibody is derived from globulin and has high affinity for BNP, making it an effective tool for studying the function and regulation of this peptide.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TEC antibody, catalog no. 70R-4469</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DMAP1 antibody, catalog no. 20R-1081</p>

<p>Purified recombinant GIMAP5 protein (His tag)</p>

<p>DEF6 antibody was raised in Rabbit using Human DEF6 as the immunogen</p>

<p>Ajuba Monoclonal Antibody</p>

<p>MAGEE1 antibody was raised in rabbit using the C terminal of MAGEE1 as the immunogen</p>

<p>C9ORF153 antibody was raised using the middle region of C9Orf153 corresponding to a region with amino acids NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN</p>

<p>CYLD antibody was raised in Rabbit using Human CYLD as the immunogen</p>

<p>HAPLN2 antibody was raised in rabbit using the middle region of HAPLN2 as the immunogen</p>

<p>GAPDH antibody was raised in mouse using recombinant GAPDH as the immunogen.</p>

<p>Rabbit polyclonal Galectin 7 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of U1SNRNPBP antibody, catalog no. 70R-1436</p>

<p>Rabbit polyclonal MAGI2 antibody</p>

<p>Bapx1 antibody was raised in rabbit using the N terminal of BAPX1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOLC1 antibody, catalog no. 70R-1622</p>