Produits biochimiques et réactifs

<p>The GATA1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is designed to target specific virus surface antigens. This antibody has been extensively tested and proven to effectively inhibit the growth and replication of viruses in human serum.</p>

<p>SOX6 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 6 (Sox6),</p>

<p>Mouse monoclonal PNPO antibody</p>

<p>N-Omega-allyl-L-arginine is a synthetic peptide with inhibitory activity against protein interactions. It has been used as a research tool to study the activation of ion channels, receptor binding, and ligand binding. N-Omega-allyl-L-arginine is also an activator of the nitric oxide synthase enzyme. This product is a high purity, pharmaceutical grade product that can be used in life science research applications, including antibody production and cell biology.</p>

<p>The CD11d antibody is a potent phosphatase that belongs to the family of antibodies. It specifically targets alpha-fetoprotein, a glycoprotein that is involved in various biological processes. This monoclonal antibody has been shown to inhibit the activity of dopamine, collagen, and growth factors by binding to their respective receptors. Additionally, the CD11d antibody can be used as an electrode for detecting specific proteins or molecules in various life science applications. It has also demonstrated inhibitory effects on the circumsporozoite protein, which is essential for the survival of certain parasites. With its versatile properties and wide range of applications, the CD11d antibody is a valuable tool in research and diagnostics.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DMPK antibody, catalog no. 70R-3702</p>

<p>MOCOS antibody was raised in Rabbit using Human MOCOS as the immunogen</p>

<p>Rabbit polyclonal VASP antibody (Ser238)</p>

<p>Rabbit Polyclonal eIF4B antibody (Ser422)</p>

<p>PADI2 antibody was raised using the middle region of PADI2 corresponding to a region with amino acids RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV</p>

<p>Purified Polyclonal Caspase 7 p11 antibody</p>

<p>Rabbit polyclonal SNX15 antibody</p>

<p>LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK</p>

<p>Purified recombinant Human ADPRH protein (His tag)</p>

<p>Rabbit polyclonal RPS12 antibody</p>

<p>GPSM1 antibody was raised in Rabbit using Human GPSM1 as the immunogen</p>

<p>Mouse monoclonal PAICS antibody</p>

<p>Rabbit Polyclonal CHSS2 antibody</p>

<p>The eNOS antibody is a monoclonal antibody used in Life Sciences research. It specifically targets endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody is widely used to study the role of eNOS in various physiological processes, including lipoprotein lipase activity, antiviral responses, and growth factor signaling pathways. The eNOS antibody can be immobilized on electrodes or used in colloidal form for detection and quantification of eNOS in samples such as human serum. Additionally, this antibody has been shown to have neuroprotective effects and can modulate interferon signaling pathways. Its high specificity and ability to recognize different forms of eNOS due to glycosylation make it a valuable tool for researchers studying various cellular processes.</p>

<p>Purified Polyclonal NKX31 antibody</p>

<p>The XIAP antibody is a hormone peptide that belongs to the class of antibodies. It specifically targets serum albumin, particularly human serum albumin, and acts as a neutralizing agent. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on various growth factors, chemokines, and epinephrine-like molecules. The XIAP antibody is available in both polyclonal and monoclonal forms, making it suitable for different research applications. Its high specificity and affinity make it an essential tool for studying protein-protein interactions and signaling pathways. With its ability to block the activity of specific molecules, the XIAP antibody offers great potential for therapeutic interventions in various diseases.</p>

<p>Human IgE antibody was raised in mouse using immunoglobulin E from myelomatous human serum.</p>

<p>FAP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal STX7 antibody</p>

<p>LOC728331 antibody was raised using the N terminal of LOC728331 corresponding to a region with amino acids AALGRTRAPNGATPRGEDGLSPTPTPGTDASGKGRGRPGKRGAPGGRADP</p>

<p>Rabbit polyclonal CDC25A antibody</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>GaTx2 is a costimulatory molecule that binds to the B7-1 and B7-2 receptors on the surface of antigen-presenting cells. GaTx2 has been shown to regulate transcriptional regulation, cellular growth, and physiological function in heart tissue. It is also involved in the development of cancer and autoimmune diseases. GaTx2 has biological properties that are similar to those of T lymphocyte growth factor (TGF) and basic fibroblast growth factor (bFGF). GaTx2 is also a whole-cell voltage clamp that can be used in tissue culture.</p>

<p>Purified recombinant Human GP9 protein (His tag)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Recombinant Human MOSPD1 protein</p>

<p>DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL</p>

<p>The CaMK4 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets and binds to CaMK4, which stands for calcium/calmodulin-dependent protein kinase 4.</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA</p>

<p>MGAT5B antibody was raised in Rabbit using Human MGAT5B as the immunogen</p>

<p>Keratin K13 antibody was raised in mouse using Keratin preparation from human esophagus as the immunogen.</p>

<p>The Pgf protein is a growth factor that plays a crucial role in the development and maintenance of pluripotent stem cells. It is commonly used in research laboratories and the pharmaceutical industry. The Pgf protein is produced using advanced techniques such as glycerin-based expression systems and polymerase chain reaction (PCR) amplification. Its purity and quality are ensured through rigorous cytometry analysis and neutralizing assays.</p>

<p>The SHC1 antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in research and life sciences for immobilization and detection purposes. This antibody is available in both polyclonal and monoclonal forms, offering researchers a wide range of options to suit their specific needs.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP</p>

<p>The CEA antibody is a powerful growth factor that plays a crucial role in various biological processes. It interacts with transferrin and TNF-α to regulate hepatocyte growth and function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One notable application is its use as a targeted therapy. The CEA antibody, when conjugated with other therapeutic agents such as trastuzumab (anti-HER2 antibody), can specifically target cancer cells that overexpress certain markers, leading to their selective destruction. This targeted approach minimizes damage to healthy cells and reduces side effects. Additionally, the CEA antibody has been found to be an effective tool in research and diagnostics. It can be used as an activated electrode for the detection of specific biomarkers, such as annexin or chemokines, allowing for precise measurements and analysis. Moreover, monoclonal antibodies against CEA have been developed for the detection and quantification of CEA levels</p>

<p>C10ORF12 antibody was raised using the middle region of C10Orf12 corresponding to a region with amino acids LPKAEVQSKRKRTEGSSPPDSKNKGPTVKASKEKHADGATKTPAAKRPAA</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The SAT1 antibody is a polyclonal antibody that specifically targets the activated form of an oncogenic kinase. It is widely used in Life Sciences research for various applications, including immunoassays and protein detection. This antibody can be immobilized on surfaces such as microplates or beads for easy and efficient binding to its target protein. The SAT1 antibody has been extensively validated and shown to have high specificity and sensitivity in detecting the growth factor it binds to. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. With its ability to bind to specific epitopes on the target protein, this antibody serves as a valuable tool for studying the role of growth factors and their interactions with other proteins. Whether you are conducting basic research or developing therapeutic inhibitors, the SAT1 antibody is an essential component in your toolkit.</p>

<p>TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7210</p>

<p>The CD27 antibody is a monoclonal antibody that targets the CD27 protein, which plays a crucial role in immune response and cell signaling. This antibody is widely used in life sciences research to study the function and regulation of CD27. It has been shown to inhibit the growth of certain cancer cells by blocking the interaction between CD27 and its ligand. Additionally, the CD27 antibody has been found to have anti-inflammatory properties and can modulate immune responses by promoting the production of interleukin-6 and other cytokines. Its acidic nature allows for efficient binding to target cells, making it an effective tool for various experimental techniques such as flow cytometry and immunohistochemistry. The CD27 antibody is a valuable asset in understanding the complex mechanisms of immune regulation and holds great potential for therapeutic applications in the future.</p>

<p>ZNF534 antibody was raised in rabbit using the middle region of ZNF534 as the immunogen</p>

<p>Cpne6 antibody was raised in rabbit using the C terminal of Cpne6 as the immunogen</p>

<p>Purified Polyclonal PLC gamma 1 antibody</p>

<p>ADRA1B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant ACAD8 protein (His tag)</p>

<p>SGCB protein is an important component of the cell membrane and plays a crucial role in muscle function. It is an antigen that can be targeted by antibodies, making it a valuable tool for research and diagnostic purposes. The SGCB protein has been shown to have anti-glial fibrillary acidic properties, which may be relevant in the treatment of certain neurological disorders. Additionally, conjugated proteins containing SGCB can be used as inhibitors or therapeutic agents. Monoclonal antibodies targeting SGCB protein have been developed and are widely used in various applications, including immunoassays and immunohistochemistry. The detection of SGCB protein in human serum samples has proven to be a useful biomarker for certain diseases. Overall, the SGCB protein is a significant molecule in life sciences research with diverse applications and potential therapeutic implications.</p>

<p>Purified recombinant CALR3 protein</p>

<p>RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR</p>

<p>The RAB27B antibody is a polyclonal antibody that specifically targets the RAB27B protein. This protein plays a crucial role in various cellular processes, including acrosome reactions and calcium binding. By binding to RAB27B, this antibody can modulate its function and exert immunomodulatory effects.</p>

<p>Rabbit polyclonal Chk1 antibody (Ser345)</p>

<p>Rabbit polyclonal TPST1 antibody</p>

<p>Purified recombinant ANKRA2 protein (His tag)</p>

<p>OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS</p>

<p>LPCAT4 antibody was raised in Rabbit using Human LPCAT4 as the immunogen</p>

<p>Mouse monoclonal C2orf40 antibody</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>Goat anti-rabbit IgG (H+L) (Poly-HRP40) was raised in goat using rabbit IgG as the immunogen.</p>

<p>Portion of EBV EBNA 4NP</p>

<p>Rabbit Polyclonal PLEKHG3 antibody</p>

<p>Rat monoclonal CIRE antibody (PE)</p>

<p>Rabbit polyclonal bZIP23 antibody</p>

<p>Rabbit polyclonal IL6 antibody (FITC)</p>

<p>Rabbit polyclonal GS15 antibody</p>

<p>SPAG8 antibody was raised using the N terminal of SPAG8 corresponding to a region with amino acids SGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSH</p>

<p>KIF1B antibody was raised in Rabbit using Human KIF1B as the immunogen</p>

<p>Pancreastatin antibody was raised in rabbit using synthetic pancreastatin as the immunogen.</p>

<p>Mouse Lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.</p>

<p>Melinamide is a fatty acid analog that is used for the treatment of inflammatory bowel disease. It has been shown to regulate the production of pro-inflammatory cytokines, such as tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β), in rat liver microsomes. Melinamide has also been shown to decrease oxidative stress on heart tissue and reduce metabolic disorders, such as type 2 diabetes, in rats. In addition, melinamide inhibits the production of TNF-α by human macrophages and reduces inflammation caused by bowel disease in rats. Melinamide is not active against bacterial infections and does not have any significant effects on skin cells or x-ray crystal structures.</p>

<p>Hps3 antibody was raised in rabbit using the N terminal of Hps3 as the immunogen</p>

<p>The CD43 antibody is a monoclonal antibody used in Life Sciences research. It targets the CD43 protein, which is involved in various cellular processes including mitogen-activated protein and growth factor signaling. The antibody has been shown to inhibit the polymerase activity of activated cells and has cytotoxic effects on certain cell types. Additionally, it has antiviral properties and can target Mycoplasma genitalium, an acidic bacterium that causes infections in humans. The CD43 antibody also interacts with nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), endonuclease caspase-9, and β-catenin, further highlighting its potential applications in molecular biology research.</p>

<p>Rabbit Polyclonal EIF2S2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIML2 antibody, catalog no. 70R-4258</p>

<p>NLGN4X antibody was raised using the N terminal of NLGN4X corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN</p>

<p>The RGS4 antibody is a highly specialized antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to the RGS4 protein, which plays a crucial role in various cellular processes. This antibody is monoclonal, meaning it is derived from a single clone of cells and therefore offers high specificity and consistency in its performance.</p>

<p>C1ORF110 antibody was raised using the N terminal Of C1Orf110 corresponding to a region with amino acids LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED</p>

<p>GUCY1B3 antibody was raised using the N terminal of GUCY1B3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV</p>

<p>Purified recombinant Human HBXIP protein (His tag)</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>The GLO1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the glyoxalase 1 enzyme, which plays a crucial role in detoxifying harmful reactive carbonyl compounds. This antibody has been extensively studied for its potential antiviral properties and has shown promising results in inhibiting viral replication.</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>LSS antibody was raised in Rabbit using Human LSS as the immunogen</p>

<p>VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ</p>

<p>The RCC1 antibody is a serum marker that is used in various assays and research in the field of Life Sciences. It is a monoclonal antibody that specifically targets RCC1, an important protein involved in cell cycle regulation. This antibody can be used to detect the presence of RCC1 in biological samples, making it a valuable tool for studying its expression and function. Additionally, the RCC1 antibody has been shown to have potential therapeutic applications, as it can be used to develop targeted medicines against diseases associated with abnormal RCC1 levels. With its high specificity and sensitivity, this antibody is widely used by researchers and scientists in their studies on sirtuins, interleukins, carnitine metabolism, and antiviral mechanisms.</p>

<p>The NEU2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to neutralize the toxic effects of alpha-fetoprotein (AFP) in human serum. By binding to AFP, the NEU2 antibody prevents its interaction with cell surface receptors and inhibits its downstream signaling pathways. This inhibition leads to a decrease in the production of colony-stimulating factors and other growth factors that are essential for tumor growth and metastasis.</p>

<p>Purified recombinant WBP2 protein (His tag)</p>

<p>Norfloxacin N Conjugate for use in immunoassays</p>

<p>Mouse monoclonal PTPN11 antibody</p>

<p>TUBB2b antibody was raised in mouse using recombinant human TUBB2b (1-445aa) purified from E. coli as the immunogen.</p>

<p>The HPV 18 protein is a recombinant protein that belongs to the category of Recombinant Proteins &amp; Antigens. It is commonly used in life sciences research and various applications related to proteins and antigens. This protein can be used in studies involving monoclonal antibodies, interferon, and antigen-antibody reactions. It has been shown to be activated when exposed to histidine and can generate autoantibodies and cytotoxic effects. Additionally, the HPV 18 protein has neutralizing properties and can be used for anticoagulation purposes. Researchers often utilize this protein in conjunction with electrodes for various experiments and analyses.</p>