Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.116 produits)
- Par Biological Target(99.076 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.698 produits)
- Métabolites secondaires(14.220 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
LTA4H antibody
<p>The LTA4H antibody is a monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to LTA4H, an enzyme involved in the metabolism of fatty acids. This antibody has a low density and is highly specific, making it an ideal tool for research and diagnostic purposes. The LTA4H antibody can be used in various applications, including immunoassays, Western blotting, immunohistochemistry, and flow cytometry. It is produced using advanced nanocomposite technology, which ensures high purity and stability. This antibody is supplied with all necessary excipients and can be easily activated for use in different experimental setups. In addition to its research applications, the LTA4H antibody has also shown potential as an antiviral agent against certain viral infections.</p>3-[(4-Fluorophenyl)methyl]-2-methyl-4,9-dioxo-1-(phenylmethyl)-1H-naphth[2,3-d]imidazolium chloride
CAS :<p>3-[(4-Fluorophenyl)methyl]-2-methyl-4,9-dioxo-1-(phenylmethyl)-1H-naphth[2,3-d]imidazolium chloride (IMC) is a small molecule that inhibits the autophagy pathway. Autophagy is a process by which cells break down and recycle their own components to provide energy or to eliminate toxic substances. IMC has been shown to inhibit the growth of glioma cells in tissue culture, as well as human malignant brain tumors in vivo. IMC also blocks epidermal growth factor receptor (EGFR) signaling by targeting EGFR downstream molecules such as ERK and AKT.</p>Formule :C26H20ClFN2O2Degré de pureté :Min. 95%Masse moléculaire :446.9 g/molGSK 2256294A
CAS :<p>GSK 2256294A is a diazonium salt that is used to treat bowel diseases. It has been shown to inhibit the production of fatty acid metabolites, such as epoxyeicosatrienoic acids (EETs), and reduce the number of autophagy-positive cells in diabetic patients. This molecule also has cancer-fighting properties and can be used to treat various types of cancers, including colon cancer, breast cancer, and prostate cancer. GSK 2256294A is currently undergoing preclinical studies for treatment of inflammatory bowel disease, cardiovascular disease, and liver disease.</p>Formule :C21H24F3N7ODegré de pureté :Min. 95%Masse moléculaire :447.46 g/molHCV Core/NS3/NS4/NS5 Antigen, Recombinant
<p>HCV Core/NS3/NS4/NS5 Antigen, Recombinant is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about HCV Core/NS3/NS4/NS5 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Ro 5-3335
CAS :<p>Ro 5-3335 is a synthetic substance that inhibits the production of tumor necrosis factor-α (TNF-α), which is a cytokine that has been shown to induce choroidal neovascularization. Ro 5-3335 has synergistic effects with other drugs such as fluorescein, which can be used to study the progression of choroidal neovascularization in vivo. The anti-inflammatory effect of Ro 5-3335 may be due to its ability to inhibit the synthesis of TNF-α by binding to TNF-α response elements on DNA. This drug also induces cell death by inhibiting growth factor or messenger RNA production or by acting on specific cells such as toll-like receptor 2 and 4.</p>Formule :C13H10ClN3ODegré de pureté :Min. 95%Masse moléculaire :259.69 g/mol3-Hydroxybenzoyl coenzyme A
CAS :<p>3-Hydroxybenzoyl coenzyme A is a potent anticancer agent that acts as an inhibitor of apoptosis. It is found in urine and has been used as a medicinal compound for the treatment of cancer in humans. 3-Hydroxybenzoyl coenzyme A inhibits the activity of kinases and proteins involved in cell cycle regulation, which leads to apoptosis or programmed cell death. This compound has been shown to be effective against Chinese hamster ovary cells and other cancer cell lines. Its analogs have also been developed for use as tumor inhibitors. Overall, 3-Hydroxybenzoyl coenzyme A has great potential as a therapeutic agent for the treatment of various types of cancer.</p>Formule :C28H40N7O18P3SDegré de pureté :Min. 95%Masse moléculaire :887.6 g/molCD3E antibody
<p>The CD3E antibody is a mouse monoclonal antibody that specifically targets the CD3E protein. This antibody has phosphatase activity and can be used for cytotoxic assays. It works by binding to the CD3E antigen on the surface of cells, leading to an antigen-antibody reaction. The CD3E antibody is commonly used in research and diagnostic applications, such as immunoassays and delta-9-tetrahydrocannabinol detection methods. It is buffered for stability and can be used with other antibodies, including polyclonal antibodies, to enhance detection sensitivity. This monoclonal antibody is widely used in life sciences research and has been validated for use in various applications, including flow cytometry, immunohistochemistry, and Western blotting. Its high affinity for the CD3E protein makes it a valuable tool for studying immune responses and cell signaling pathways.</p>Degré de pureté :Min. 95%Parireotide diaspartate
CAS :<p>Parireotide diaspartate is a peptide that belongs to the group of activators and is used as a research tool. It can be used to activate different ion channels, such as calcium channels. In cell biology, it has been shown to inhibit protein interactions and receptor-ligand binding. Parireotide diaspartate has also been reported to have pharmacological properties, including the ability to inhibit protein synthesis and act as an antagonist at glutamate receptors.</p>Formule :C66H80N12O17Degré de pureté :Min. 95%Masse moléculaire :1,313.4 g/molJHU395
CAS :<p>JHU395 is a research tool that can be used to activate or inhibit the receptor. It is a ligand that binds to its receptor and initiates a series of cellular responses. JHU395 has been shown to have an effect on ion channels, cell biology, and pharmacology. This compound may be useful in the treatment of conditions such as Alzheimer's disease, Parkinson's disease, and schizophrenia.</p>Formule :C22H29N3O7Degré de pureté :Min. 95%Masse moléculaire :447.5 g/molMuscarinic Toxin 3
<p>A synthetic snake venom peptide, sourced from the Green Mamba, Dendroaspis angusticeps. It can be applied as a specific ligand for Muscarinic Acetylcholine Receptor-4 (M4) and this product is available as a 0.1mg vial with disulfide bonds between Cys3- Cys24, Cys17- Cys42, Cys46- Cys57, and Cys58- Cys63.</p>Formule :C319H489N89O97S8Degré de pureté :Min. 95%Masse moléculaire :7,379.4 g/molGoat anti Human κ chain (HRP)
<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>Degré de pureté :Min. 95%Dinoterb
CAS :<p>Dinoterb is a potent anticancer agent that belongs to the group of kinase inhibitors. It has been shown to induce apoptosis in cancer cells, making it an effective treatment for various types of tumors. Dinoterb has been found to be particularly effective against Chinese hamster ovary cells and human leukemia cells. This drug works by inhibiting the cell cycle, which prevents cancer cells from dividing and growing. Dinoterb is excreted mainly through urine and has been used in medicinal preparations as an inhibitor of protein kinases involved in cancer development. Its anti-tumor activity makes it a promising candidate for further research into cancer treatments.</p>Formule :C10H12N2O5Degré de pureté :Min. 95%Masse moléculaire :240.21 g/molCD38 antibody (biotin)
<p>CD38 antibody (biotin) was raised in rat using CD38 as the immunogen.</p>Degré de pureté :Min. 95%Syntrophin γ 1 antibody
<p>Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS</p>NSC-13755
CAS :<p>NSC-13755 is a synthetic molecule that inhibits the activity of topoisomerase II, a type of enzyme that maintains the integrity of DNA. NSC-13755 has been shown to inhibit cancer cell growth and induce apoptosis in vitro. Clinical data suggests that NSC-13755 is more potent than other macrocyclic inhibitors, such as doxorubicin and etoposide, when used in combination therapy with gemcitabine for the treatment of pancreatic cancer. In vivo studies have demonstrated that NSC-13755 has potent anti-cancer activity against resistant cancer cells with a high level of expression for this enzyme.</p>Formule :C7H6NO7SbDegré de pureté :Min. 95%Masse moléculaire :337.88 g/molGoat anti Human IgG (HRP)
<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>Degré de pureté :Min. 95%RAVER1 antibody
<p>RAVER1 antibody was raised using the middle region of RAVER1 corresponding to a region with amino acids ALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPAGGGLPPEL</p>Rotavirus protein
<p>Rotavirus grade 3 Antigen. Taxonomy: Rheoviridae/Rotavirus/Rotavirus A/Simian rotavirus SA11. Virions consist of a capsid, a core, and a nucleoprotein complex. Virus capsid is not enveloped. Capsid/nucleocapsid is isometric with icosahedral symmetry and has a diameter of 80 nm. The genome is segmented and consists of eleven segments of linear double-stranded RNA. Rotavirus is the most common cause of severe diarrhea among children.</p>Degré de pureté :Concentration 1.0Ml Of Inactivated RotavirusSIAH1 Blocking Peptide
<p>The SIAH1 Blocking Peptide is a high-quality product offered by Life Sciences. This peptide is commonly used in the field of Peptides and Biochemicals for its exceptional ability to neutralize TGF-beta in human serum. It contains a unique disulfide bond structure that ensures its stability and effectiveness.</p>Degré de pureté :Min. 95%SPIC antibody
<p>The SPIC antibody is a highly specialized polyclonal antibody that targets endothelial growth factor. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically binds to tyrosine residues on the endothelial growth factor, neutralizing its activity and preventing further growth stimulation. The SPIC antibody has shown promising results in inhibiting the growth of various types of cells, including those expressing the circumsporozoite protein and glucagon receptors. Additionally, it exhibits neurotrophic and neuroprotective effects, making it a valuable tool for studying neuronal development and regeneration. With its high specificity and affinity, the SPIC antibody is an essential component in many research projects focused on understanding growth factors and their role in various biological processes.</p>ICA
CAS :<p>ICA is a diagnostic imaging technique that evaluates the carotid artery for signs of acute ischemic injury. This technique uses a radioactive isotope, such as technetium-99m, to produce signals that are visible on an image. ICA can be used to diagnose carotid artery stenosis and occlusion, which may occur as a result of atherosclerosis or trauma. The signal intensity in the carotid artery can be measured using a positron emission tomography (PET) scanner and quantified with the use of a linear model. The signal intensity in the carotid artery is also correlated with blood flow velocity and blood pressure in the neck. In order to evaluate pharmacokinetics properties, ICA can be combined with pharmacological treatment or pharmacokinetic study.</p>Formule :C13H10N4SDegré de pureté :Min. 95%Masse moléculaire :254.31 g/molTUBA1C antibody
<p>The TUBA1C antibody is a hormone peptide that acts as an inhibitory factor. It is a cytotoxic antibody that targets antiphospholipid antibodies in the human serum. This monoclonal antibody has been shown to inhibit the activity of interferon, dopamine, and leukemia inhibitory factor. Additionally, it has been found to possess anticoagulant properties. The TUBA1C antibody is a highly specific and potent inhibitor that can be used in various research and clinical applications. Its unique characteristics make it an essential tool for studying autoimmune disorders and developing targeted therapies.</p>p35 antibody
<p>The p35 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets actin filaments and has been extensively studied for its role in various cellular processes. This antibody has shown high specificity and affinity towards actin, making it an essential tool for researchers studying actin dynamics and cytoskeletal organization.</p>WNT16 antibody
<p>The WNT16 antibody is a highly reactive polyclonal and monoclonal antibody that specifically binds to antigen binding molecules. It has been extensively studied in the field of Life Sciences for its role in various biological processes. The WNT16 antibody has shown to inhibit the activity of phosphatase, interleukin-6, and cysteine-rich proteins, which are involved in important cellular signaling pathways. Additionally, it has been found to exhibit cytotoxic effects on human serum and can block the transmembrane conductance of certain chemokines. With its high specificity and potent inhibitory properties, the WNT16 antibody is a valuable tool for researchers studying activated signaling pathways and exploring potential therapeutic targets.</p>FGF10 antibody
<p>FGF10 antibody was raised in goat using highly pure recombinant human FGF-10 as the immunogen.</p>Degré de pureté :Min. 95%RPS16 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>EDNRA antibody
<p>The EDNRA antibody is a polyclonal antibody that has been extensively studied and widely used in various applications. It is commonly used in CDNA microarray experiments to analyze gene expression profiles and identify potential biomarkers. The EDNRA antibody specifically targets the endothelin receptor type A (EDNRA), which plays a crucial role in cellular immunotherapy and the development of targeted therapies for various diseases.</p>PSMC6 antibody
<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>Degré de pureté :Min. 95%LRRC2 antibody
<p>LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA</p>TRPV4 antibody
<p>The TRPV4 antibody is a highly specialized monoclonal antibody that targets the transient receptor potential vanilloid 4 (TRPV4) channel. This channel plays a crucial role in various physiological processes, including natriuretic regulation, fibrinogen production, and cellular response to mechanical stress. The TRPV4 antibody has been extensively tested in human serum and has shown excellent specificity and sensitivity in detecting TRPV4 expression.</p>HA Tag antibody
<p>The HA Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to specifically bind to the HA (hemagglutinin) epitope, which is commonly fused to target molecules for various applications. The HA Tag antibody is commonly used in immunoassays and antigen binding experiments to detect and quantify the expression of target proteins.</p>USP38 antibody
<p>USP38 antibody was raised in rabbit using the middle region of USP38 as the immunogen</p>Degré de pureté :Min. 95%Lobetyolin
CAS :<p>Lobetyolin is a polyphenolic compound that belongs to the class of lignans. It has been shown to possess antioxidant and anti-inflammatory properties, as well as inhibitory effects on the mucin gene. Lobetyolin is extracted from the root of pueraria lobata using subcritical water extraction, which is an analytical method for determining the concentration of this compound in the plant. The extraction process involves a polymerase chain reaction (PCR) technique with radix pueraria lobata, signal pathways, and codonopsis. This extract can be used in the production of dietary supplements containing calcium pantothenate and protocatechuic acid.</p>Formule :C20H28O8Degré de pureté :Min. 95%Masse moléculaire :396.4 g/molPAPOLB antibody
<p>PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM</p>Streptococcus Group B antibody (biotin)
<p>Streptococcus group B antibody (biotin) was raised in rabbit using group B Streptococci as the immunogen.</p>Degré de pureté :Min. 95%CD90.2 antibody (FITC)
<p>CD90.2 antibody (FITC) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.</p>Degré de pureté :Min. 95%COMT Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMT antibody, catalog no. 70R-7143</p>Degré de pureté :Min. 95%AZD3839
CAS :<p>AZD3839 is a potent and selective inhibitor of the enzyme factor Xa. This drug has been shown to be effective in animal models of hypopigmentation and diseases related to muscle function. AZD3839 inhibits the activity of factor Xa by binding to the active site, preventing its proteolytic cleavage of factors Va and VIIIa. The inhibition of factor Xa prevents the production of thrombin, which is responsible for blood clotting. In humans, AZD3839 has been shown to have no effect on platelet aggregation or bleeding time. Clinical trials are ongoing to determine whether AZD3839 will be effective in treating human liver disease caused by antithrombotic drugs (e.g., warfarin).</p>Formule :C24H16F3N5Degré de pureté :Min. 95%Masse moléculaire :431.41 g/molROCK2 antibody
<p>The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.</p>Streptococcus Group A antibody (HRP)
<p>Streptococcus group A antibody (HRP) was raised in goat using group A streptococci as the immunogen.</p>Degré de pureté :Min. 95%SMANT hydrochloride
CAS :<p>SMANT hydrochloride is a peptide that is used in research as a tool for investigating protein interactions and the effects of ligands on receptors. SMANT hydrochloride binds to ion channels and receptor proteins, which modulates their activity. The SMANT hydrochloride molecule has an inhibitor effect on certain enzymes such as ATPases and transporters. It also inhibits the production of reactive oxygen species by activating the Nrf2 transcription factor, which regulates antioxidant genes.</p>Formule :C16H23BrN2O·HClDegré de pureté :Min. 95%Masse moléculaire :375.73 g/molSSR 69071
CAS :<p>SSR 69071 is a small-molecule inhibitor of the serine protease activated by covalent binding. It has been shown to inhibit the activity of the enzyme in vitro and in vivo, and is able to inhibit growth factor-induced proliferation in cells. SSR 69071 has also been shown to be effective against diabetic neuropathy and cardiac infarction, as well as other inflammatory diseases. The exact mechanism of action is not yet known, but it may be due to its ability to inhibit peptidases, which are enzymes that break down proteins into smaller peptides. SSR 69071 also inhibits reactive oxygen species (ROS), which are molecules that can cause oxidative stress and damage cells. The inhibition of ROS may be responsible for some of the drug’s anti-inflammatory effects.</p>Formule :C27H32N4O7SDegré de pureté :Min. 95%Masse moléculaire :556.63 g/molAxitinib-d3
CAS :<p>Please enquire for more information about Axitinib-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C22H18N4OSDegré de pureté :Min. 95%Masse moléculaire :389.5 g/molCD152 antibody (Azide Free)
<p>CD152 antibody (Azide free) was raised in hamster using keat-killed Staphylococcus A bacteria coated with murine CTLA-4/human IgG1 fusion protein as the immunogen.</p>Degré de pureté :Min. 95%M-89
CAS :<p>M-89 is a monoclonal antibody that targets fatty acid binding protein 4 (FABP4) and inhibits the uptake of lipids in muscle cells. M-89 has been shown to be clinically relevant for women with atherosclerotic cardiovascular disease and also for those who are obese. M-89 has shown some promise as a diagnostic tool for polymyositis, dermatomyositis, systemic lupus erythematosus, and other inflammatory muscle diseases. The experimental model system used to assess the efficacy of M-89 was a rat model of polymyositis induced by injection of an allergen into the thigh muscle. In this study, M-89 inhibited lipid uptake by blocking FABP4, which is located on the surface of muscle cells. This inhibition led to decreased levels of proinflammatory cytokines that are responsible for causing muscle damage.</p>Formule :C37H47N5O4SDegré de pureté :Min. 95%Masse moléculaire :657.9 g/molCarphenazine
CAS :<p>Carphenazine is a phenothiazine antipsychotic drug. It is used in the treatment of chronic schizophrenia and other psychoses, as well as for relief of nausea and vomiting. Carphenazine has been shown to be an effective agent for reducing the symptoms of chronic schizophrenia, such as hallucinations, delusions, and bizarre behavior. It is also used to treat inflammatory diseases. Carphenazine is marketed in a variety of formulations including tablets, capsules, elixirs, syrups, suppositories, ampules and injections. These formulations are designed to provide prolonged release of carphenazine over several hours or days. The drug is insoluble in water but soluble in alcohols and polyethylene glycols.br>br>Carphenazine can be prepared as an analog by substituting one or more hydrogen atoms with nitrogen atoms at the 6th position on the benzene ring.br>br>It can also be prepared as a polymer by inserting it into an insoluble polymer</p>Formule :C24H31N3O2SDegré de pureté :Min. 95%Masse moléculaire :425.6 g/molMBD1 antibody
<p>MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ</p>Licoflavone A
CAS :<p>Licoflavone A is a natural sweetener with inhibitory activity against bacteria, fungi and viruses. It has been shown to have an activity index of 0.7-0.8. Licoflavone A inhibits the growth of many bacteria such as Staphylococcus aureus, Escherichia coli, Streptococcus pneumoniae, Klebsiella pneumoniae, Salmonella enterica and Pseudomonas aeruginosa by binding to the enzyme PTP1B. The compound also inhibits phosphatase activity in echinatin and glycyrrhiza species and has been found to be active against influenza virus in vitro. Licoflavone A displays antioxidant properties by inhibiting lipid peroxidation in cells treated with hydrogen peroxide or other reactive oxygen species (ROS).</p>Formule :C20H18O4Degré de pureté :Min. 95%Masse moléculaire :322.4 g/molJP4-039
CAS :<p>JP4-039 is a polymerase chain inhibitor that has been shown to have antimicrobial effects against bacteria. JP4-039 has been used as a model system for bowel disease and iron homeostasis in tissue culture. JP4-039 is also an effective and reactive proton donor, which can be used to treat ulceration, radiation injury, and other reactive conditions. JP4-039 is also known to inhibit ATP production by inhibiting the mitochondrial membrane potential.</p>Formule :C23H42N3O4Degré de pureté :Min. 95%Masse moléculaire :424.6 g/molProtac B-raf degrader 1
CAS :<p>Protac B-raf degrader 1 is a high purity, recombinant, single chain antibody fragment that specifically binds to the activated form of Raf. Protac B-raf degrader 1 is an inhibitor of Raf and can be used as a research tool for pharmacology studies to investigate Raf pathway activation.</p>Formule :C36H37N5O12SDegré de pureté :Min. 95%Masse moléculaire :763.77 g/molSKF 38393 hydrobromide
CAS :<p>Dopamine (D1) receptor agonist</p>Formule :C16H17NO2·HBrDegré de pureté :Min. 95%Masse moléculaire :336.22 g/molFR 236924
CAS :<p>FR 236924 is a potent inhibitor that blocks the activity of cycloheximide, a phosphatase. It has been shown to inhibit the growth of granule neurons and to have neurotrophic effects on cultured cells. This drug also has anti-inflammatory properties and inhibits acetylcholine release in rat erythrocytes. The molecular mechanism of action is not well understood, but it may be due to its ability to activate transcription-polymerase chain reactions.</p>Formule :C20H36O2Degré de pureté :Min. 95%Masse moléculaire :308.5 g/molBelvarafenib
CAS :<p>Belvarafenib is a targeted therapeutic compound categorized as a novel RAF kinase inhibitor. It is sourced through chemical synthesis, designed specifically to target and inhibit aberrant kinase activity in cancer cells. The mode of action involves the selective inhibition of the RAF protein kinases, particularly BRAF, which play a pivotal role in the MAPK/ERK signaling pathway. By interrupting this signal transduction cascade, Belvarafenib effectively halts the proliferation of cancerous cells harboring specific BRAF mutations.</p>Formule :C23H16ClFN6OSDegré de pureté :Min. 95%Masse moléculaire :478.93 g/molFXYD5 antibody
<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST</p>OR2D3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2D3 antibody, catalog no. 70R-9860</p>Degré de pureté :Min. 95%ITGB4 antibody
<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>ALS2CR12 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALS2CR12 antibody, catalog no. 70R-3279</p>Degré de pureté :Min. 95%BI8626
CAS :<p>BI8626 is a covalent inhibitor of the ubiquitin ligases that are involved in the proteasome pathway. It has been shown to have anti-cancer and anti-inflammatory properties. BI8626 is a small molecule that targets e3 ubiquitin ligases, which are enzymes that regulate protein degradation by ubiquitination. Low expression of these enzymes has been observed in cancer cells and inflammatory diseases. The mechanism of action for BI8626 is not well understood but it is thought that this drug inhibits the proteasome pathway, leading to reduced inflammation and tumor growth.</p>Formule :C25H28N8Degré de pureté :Min. 95%Masse moléculaire :440.5 g/molIL11R α antibody
<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>Degré de pureté :Min. 95%MCART6 antibody
<p>MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV</p>Degré de pureté :Min. 95%RO9021
CAS :<p>RO9021 is a synthetic peptide, which is derived from bacterial lipoproteins, with a mechanism of action that targets and modulates specific inflammatory pathways. This peptide interacts with cell surface receptors, such as Toll-like receptors (TLRs), to inhibit the signaling cascades that lead to the production of pro-inflammatory cytokines. By acting on these crucial pathways, RO9021 effectively reduces inflammation and can modulate immune responses.</p>Formule :C18H25N7ODegré de pureté :Min. 95%Masse moléculaire :355.44 g/molRUNX3 antibody
<p>RUNX3 antibody was raised in rabbit using the C terminal of RUNX3 as the immunogen</p>Degré de pureté :Min. 95%NTRC 824
CAS :<p>NTRC 824 is an innovative bioactive compound, meticulously developed from natural sources, with unique properties that facilitate its mode of action. The compound is derived through an advanced extraction and purification process ensuring its optimal efficacy and stability. NTRC 824 operates by modulating specific molecular pathways, which are central to its function in targeted applications.</p>Formule :C25H26F3N3O6SDegré de pureté :Min. 95%Masse moléculaire :553.6 g/molMMD2 antibody
<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>CD56 antibody (PE-CY5.5)
<p>CD56 antibody (PE) was raised in mouse using human CD56 as the immunogen.</p>Degré de pureté :Min. 95%PPP1R13L antibody
<p>PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)</p>TG53
CAS :<p>TG53 is an innovative organic compound, which is synthesized through advanced organic chemistry techniques. Its source involves the complex coupling of select organic precursors that allows for precise control over the resultant molecular architecture. The mode of action of TG53 involves its high reactivity with specific biological macromolecules, facilitating targeted biochemical interactions that are integral for research and developmental applications.</p>Formule :C21H22ClN5O2Degré de pureté :Min. 95%Masse moléculaire :411.9 g/molCanine Coronavirus protein
<p>The Canine Coronavirus protein is a protein complex that is found in human serum. It is used in the field of Life Sciences for various purposes, including research and diagnostics. This protein complex can be used as a tool to study the interaction between viruses and host cells, as well as to develop inhibitors and monoclonal antibodies for therapeutic use. The Canine Coronavirus protein has also been shown to have viscosity-enhancing properties, which makes it useful in applications such as the measurement of creatine kinase levels in blood samples. Additionally, this protein complex can be used as a growth factor and has been found to form dimers with other proteins such as chemokines and interleukin-6. Overall, the Canine Coronavirus protein is a versatile tool that plays a crucial role in understanding and advancing our knowledge in the field of Life Sciences.</p>Degré de pureté :Min. 95%SPL-334
CAS :<p>SPL-334 is a novel, potent, and selective inhibitor of the serine protease MMP-3. It is a potential drug candidate for the treatment of metabolic disorders, such as insulin resistance, obesity, and diabetes. SPL-334 blocks the nucleophilic attack by an activated water molecule on the peptide bond between two amino acids in a protein substrate. This reaction leads to cleavage of the peptide bond and subsequent termination of protein synthesis.</p>Formule :C22H15N3O3S2Degré de pureté :Min. 95%Masse moléculaire :433.5 g/molCyclin H antibody
<p>The Cyclin H antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It has been extensively tested and validated for its performance in various applications. This antibody is designed to target the cyclin H protein, which plays a crucial role in cell cycle regulation and growth factor signaling pathways.</p>Calcitroic acid
CAS :<p>Calcitroic acid is a metabolite of vitamin D, which is derived from the enzymatic degradation of calcitriol, the hormonally active form of vitamin D3. This compound is found within biological systems as a result of the breakdown processes occurring in the liver and kidneys, orchestrated by specific enzyme activities that convert calcitriol into calcitroic acid. Its mode of action involves participation in the metabolic pathways that facilitate the regulation of calcium and phosphate homeostasis in the body, albeit as a less active form compared to its precursor, calcitriol.</p>Formule :C23H34O4Degré de pureté :Min. 95%Masse moléculaire :374.5 g/molCD4 antibody
<p>The CD4 antibody is a monoclonal antibody that specifically targets the CD4 antigen. This antibody is widely used in life sciences research to study the role of CD4 in various biological processes. The CD4 antigen is a glycoprotein found on the surface of T-helper cells, and it plays a crucial role in immune system regulation.</p>Leflunomide ep impurity F
CAS :<p>Leflunomide is a potent inhibitor of several enzymes, including pyrimidine 5'-nucleotidase, dihydropyrimidine dehydrogenase, and uracil phosphoribosyltransferase. Leflunomide ep impurity F is a research tool that can be used to study the activation of receptor-ligand interactions. It provides the ligand for binding and activation of the receptor.</p>Formule :C12H9F3N2O2Degré de pureté :Min. 95%Masse moléculaire :270.21 g/molProcalcitonin, human, recombinant
<p>Procalcitonin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 116 amino acids. Molecular weight is 12.8 kDa.amino acid sequence: APFRSALESS PADPATLSED EARLLLAALV QDYVQMKASE LEQEQEREGS SLDSPRSKRC GNLSTCMLGT YTQDFNKFHT FPQTAIGVGA PGKKRDMSSD LERDHRPHVS MPQNAN</p>Degré de pureté :Min. 95%Tavapadon
CAS :<p>Tavapadon is a peptide that binds to the GABAA receptor and enhances its activity. It is used as a research tool in cell biology and pharmacology, e.g., to study the effects of GABA on ion channels, ligand-receptor interactions, and antibody-antigen reactions. Tavapadon is also used as an inhibitor for certain types of protein interactions that are important for cell function.</p>Formule :C19H16F3N3O3Degré de pureté :Min. 95%Masse moléculaire :391.3 g/molN-(1,3-Benzothiazol-2-yl)-3,3-diphenylpropanamide
CAS :<p>N-(1,3-Benzothiazol-2-yl)-3,3-diphenylpropanamide is a peptide that is used as a research tool to activate ion channels in cells. It has been shown to be an inhibitor of the potassium channel and TASK-1 receptor. This compound also binds to the ligand binding site of the alpha 1A adrenergic receptor and has been shown to inhibit protein interactions with LFA-1 (CD11a/CD18) and ICAM-1 receptors.</p>Formule :C22H18N2OSDegré de pureté :Min. 95%Masse moléculaire :358.5 g/molMIA2 protein
<p>Region of MIA2 protein corresponding to amino acids MLESTKLLAD LKKCGDLECE ALINRVSAMR DYRGPDCRYL NFTKGEEISV YVKLAGERED LWAGSKGKEF GYFPRDAVQI EEVFISEEIQ MSTKESDFLC L.</p>Degré de pureté :Min. 95%
