Produits biochimiques et réactifs

<p>Rabbit Polyclonal CDC2 antibody (Thr161)</p>

<p>Rabbit antigen staining reagent for use in IHC</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV</p>

<p>Rabbit polyclonal SDCCAG3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-1477</p>

<p>Purified recombinant RPS18 protein (His tag)</p>

<p>Goat anti-monkey IgM (FITC) was raised in goat using monkey IgM as the immunogen.</p>

<p>Rabbit polyclonal ENPP6 antibody</p>

<p>Purified Polyclonal Cytokeratin 13 antibody</p>

<p>KNG1 antibody was raised in Rabbit using Human KNG1 as the immunogen</p>

<p>GPR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant MED21 protein (His tag)</p>

<p>The OAT antibody is a highly versatile and powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets the Organic Anion Transporter (OAT). This transporter plays a crucial role in the transport of various molecules, including growth factors, glucagon, insulin, and carbonyl groups. The OAT antibody can be used to study the expression and localization of OAT in different tissues and cell types.</p>

<p>Synaptopodin antibody was raised in mouse using Isolated rat kidney glomeruli as the immunogen.</p>

<p>Ntrk2 protein is a crucial protein involved in various biological processes. It has been shown to interact with angptl3, interferon, and other molecules in human serum. The detection of Ntrk2 protein can be achieved using techniques such as hybridization or monoclonal antibody-based assays. Life Sciences offers a range of products for the study of Ntrk2 protein, including streptavidin-conjugated proteins and antigens. These products are designed to provide accurate and reliable results in research settings. To ensure optimal performance, it is recommended to handle and store these products according to the provided instructions. With its high-quality standards and expertise in the field, Life Sciences is a trusted source for Ntrk2 protein-related products.</p>

<p>XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN</p>

<p>RRP1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBQLN4 antibody, catalog no. 70R-3308</p>

<p>1-425 amino acids: MGSSHHHHHH SSGLVPRGSH MSSILPFTPP IVKRLLGWKK GEQNGQEEKW CEKAVKSLVK KLKKTGQLDE LEKAITTQNV NTKCITIPRS LDGRLQVSHR KGLPHVIYCR LWRWPDLHSH HELRAMELCE FAFNMKKDEV CVNPYHYQRV ETPVLPPVLV PRHTEIPAEF PPLDDYSHSI PENTNFPAGI EPQSNIPETP PPGYLSEDGE TSDHQMNHSM DAGSPNLSPN PMSPAHNNLD LQPVTYCEPA FWCSISYYEL NQRVGETFHA SQPSMTVDGF TDPSNSERFC LGLLSNVNRN AAVELTRRHI GRGVRLYYIG GEVFAECLSD SAIFVQSPNC NQRYGWHPAT VCKIPPGCNL KIFNNQEFAA LLAQSVNQGF EAVYQLTRMC TIRMSFVKGW GAEYRRQTVT STPCWIELHL NGPLQWLDKV LTQMGSPSIR CSSVS</p>

<p>RAD antibody is a polyclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It is widely used in life sciences research to study the role of VEGF in angiogenesis and tumor growth. This antibody binds to activated VEGF receptors and inhibits their signaling, thereby blocking the growth and proliferation of endothelial cells. RAD antibody also shows cross-reactivity with other growth factors such as erythropoietin and epidermal growth factor. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and affinity, RAD antibody is a valuable tool for investigating the mechanisms of angiogenesis and developing antiangiogenic therapies.</p>

<p>The Nucleophosmin antibody is a highly reactive antibody that specifically targets nucleophosmin, a protein found in human serum. This antibody has been extensively studied and shown to have various applications in life sciences research. It can be used for the detection of nucleophosmin in different biological samples and has been validated for use in techniques such as Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal GPR174 antibody</p>

<p>Mouse monoclonal HAGHL antibody</p>

<p>ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Sheep polyclonal Acepromazine antibody</p>

<p>IVD antibody was raised in Rabbit using Human IVD as the immunogen</p>

<p>Purified Polyclonal CYP11B1 antibody</p>

<p>GPR6 antibody was raised using the N terminal of GPR6 corresponding to a region with amino acids NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN</p>

<p>Mouse monoclonal CD45RA antibody (biotin)</p>

<p>Purified recombinant ZNF689 protein (His tag)</p>

<p>Alpha synuclein antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 116-131 of the c-terminus of human alpha-synuclein protein as the immunogen.</p>

<p>Rabbit Polyclonal FOXR1 antibody</p>

<p>The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.</p>

<p>VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ</p>

<p>The KLH antibody is a highly specialized product in the field of Life Sciences. It is designed to detect and measure plasma nicotine levels, as well as study epithelial-mesenchymal transformation. This antibody is reactive to a specific test substance and can be used for various applications in research and diagnostics.</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Factor P antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>The GLO1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the glyoxalase 1 enzyme, which plays a crucial role in detoxifying harmful reactive carbonyl compounds. This antibody has been extensively studied for its potential antiviral properties and has shown promising results in inhibiting viral replication.</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>LSS antibody was raised in Rabbit using Human LSS as the immunogen</p>

<p>VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ</p>

<p>The RCC1 antibody is a serum marker that is used in various assays and research in the field of Life Sciences. It is a monoclonal antibody that specifically targets RCC1, an important protein involved in cell cycle regulation. This antibody can be used to detect the presence of RCC1 in biological samples, making it a valuable tool for studying its expression and function. Additionally, the RCC1 antibody has been shown to have potential therapeutic applications, as it can be used to develop targeted medicines against diseases associated with abnormal RCC1 levels. With its high specificity and sensitivity, this antibody is widely used by researchers and scientists in their studies on sirtuins, interleukins, carnitine metabolism, and antiviral mechanisms.</p>

<p>The NEU2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to neutralize the toxic effects of alpha-fetoprotein (AFP) in human serum. By binding to AFP, the NEU2 antibody prevents its interaction with cell surface receptors and inhibits its downstream signaling pathways. This inhibition leads to a decrease in the production of colony-stimulating factors and other growth factors that are essential for tumor growth and metastasis.</p>

<p>Purified recombinant WBP2 protein (His tag)</p>

<p>Norfloxacin N Conjugate for use in immunoassays</p>

<p>Mouse monoclonal PTPN11 antibody</p>

<p>TUBB2b antibody was raised in mouse using recombinant human TUBB2b (1-445aa) purified from E. coli as the immunogen.</p>

<p>The HPV 18 protein is a recombinant protein that belongs to the category of Recombinant Proteins &amp; Antigens. It is commonly used in life sciences research and various applications related to proteins and antigens. This protein can be used in studies involving monoclonal antibodies, interferon, and antigen-antibody reactions. It has been shown to be activated when exposed to histidine and can generate autoantibodies and cytotoxic effects. Additionally, the HPV 18 protein has neutralizing properties and can be used for anticoagulation purposes. Researchers often utilize this protein in conjunction with electrodes for various experiments and analyses.</p>

<p>ACTH (1-24) antibody was raised in sheep using ACTH 1-24 conjugated to thyroglobulin as the immunogen.</p>

<p>Mouse lymphocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymus and spleen cells as the immunogen.</p>

<p>Purified recombinant DHH protein (His tag)</p>

<p>OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS</p>

<p>The ZNF146 antibody is a highly specialized protein that belongs to the family of kinase inhibitors. It plays a crucial role in regulating various cellular processes, including natriuretic signaling and oncostatin activity. This human protein acts as a potent inhibitor of annexin-mediated cytotoxicity and fibrinogen immobilization. The ZNF146 antibody has shown significant potential in targeting caspase-9, an enzyme involved in programmed cell death, making it an essential tool for researchers studying apoptosis pathways. Additionally, this monoclonal antibody exhibits selective binding to acidic markers expressed by mesenchymal stem cells, making it an invaluable tool for stem cell research and therapeutic applications. With its high specificity and versatility, the ZNF146 antibody is a valuable asset for scientists seeking to unravel the intricacies of cellular mechanisms and develop innovative treatments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPEG1 antibody, catalog no. 70R-3787</p>

<p>Rabbit polyclonal TM7SF2 antibody</p>

<p>Mouse monoclonal CPO antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Marcksl1 antibody was raised in Rabbit using Human Marcksl1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zdhhc11 antibody, catalog no. 70R-8835</p>

<p>The ANXA10 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects progesterone, a steroid hormone involved in various physiological processes. This antibody can be used in immunoassays to measure progesterone levels in biological samples such as human serum or tissue extracts.</p>

<p>Rabbit polyclonal BAD antibody (Ser134)</p>

<p>Armenian Hamster monoclonal CD11c antibody (allophycocyanin)</p>

<p>HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF</p>

<p>Insulin antibody is a specialized protein that specifically binds to insulin molecules. It can be used in various research applications, such as studying the role of insulin in glucose metabolism or investigating insulin signaling pathways. The antibody is typically produced using monoclonal antibody technology, ensuring high specificity and sensitivity.</p>

<p>Mouse monoclonal TRAP1 antibody</p>

<p>SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF</p>

<p>gp210 Antibody (C-terminal)</p>

<p>The Tryptophan Hydroxylase antibody is a crucial tool in Life Sciences research. This pluripotent stem cell-derived antibody is specifically designed for the detection and analysis of Tryptophan Hydroxylase, an enzyme involved in serotonin synthesis. With its high specificity and sensitivity, this antibody enables researchers to study the role of Tryptophan Hydroxylase in various biological processes.</p>

<p>IFN lambda 2 antibody was raised in rabbit using highly pure recombinant human IFN-lambda2 as the immunogen.</p>

<p>PWWP2B antibody was raised using the N terminal of PWWP2B corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS</p>

<p>The MIP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets annexin, a protein involved in various cellular processes. This antibody can be used for the detection and quantification of annexin in biological samples. Additionally, it has been shown to have inhibitory effects on pancreatic glucagon and insulin, making it a valuable tool for studying the regulation of glucose metabolism. The MIP antibody is also used in the development of diagnostic tests for conditions such as diabetes, where aberrant levels of glucagon and insulin are observed. In addition to its applications in research, this antibody has potential therapeutic uses, particularly in the treatment of autoimmune disorders characterized by the production of autoantibodies against insulin or other target proteins.</p>

<p>1-152 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMASM RVVKELEDLQ KKPPPYLRNL SSDDANVLVW HALLLPDQPP YHLKAFNLRI SFPPEYPFKP PMIKFTTKIY HPNVDENGQI CLPIISSENW KPCTKTCQVL EALNVLVNRP NIREPLRMDL ADLLTQNPEL FRKNAEEFTL RFGVDRPS</p>

<p>GATAD2A antibody was raised in rabbit using the N terminal of GATAD2A as the immunogen</p>

<p>PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH</p>

<p>The Pyruvate Carboxylase antibody is a growth factor that acts as a neuroprotective agent. It belongs to the cytokine family and has DNA binding activity. This antibody is commonly used in the field of Life Sciences for research purposes. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein. The Pyruvate Carboxylase antibody has been shown to inhibit the activity of serine proteases and adenosine A1 receptors. Additionally, it has been found to modulate transmembrane conductance and regulate the expression of leukemia inhibitory factor. Researchers use this antibody to study various cellular processes and investigate its potential therapeutic applications.</p>

<p>GNG4 antibody was raised in Rabbit using Human GNG4 as the immunogen</p>

<p>The CD80 antibody is a monoclonal antibody that specifically targets the CD20 antigen. It is widely used in Life Sciences research to study various cellular processes involving actin filaments. The CD80 antibody binds to actin, a protein involved in cell structure and movement, and can be visualized using phalloidin, a fluorescent compound that specifically binds to actin filaments. This antibody is also commonly used in drug development as a therapeutic agent for targeting cancer cells that overexpress the CD20 antigen. The CD80 antibody has been extensively tested and validated for its specificity and efficacy in various experimental settings, making it a valuable tool for researchers studying actin dynamics and related cellular processes.</p>

<p>Mouse monoclonal anti human BUB3 antibody</p>

<p>Rabbit Polyclonal p47 phox antibody (Ser370)</p>

<p>ENA78 antibody was raised in rabbit using highly pure recombinant human ENA-78 as the immunogen.</p>

<p>Mouse monoclonal PTK2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ11171 antibody, catalog no. 70R-4076</p>

<p>Rat PMN antibody was raised in rabbit using rat PMNs as the immunogen.</p>

<p>Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF</p>

<p>ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD</p>

<p>Rabbit polyclonal OR2AG antibody</p>

<p>Rabbit polyclonal TBX10 antibody</p>

<p>KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV</p>

<p>Purified Polyclonal PFKFB1/4 antibody</p>

<p>Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT</p>

<p>The BAK antibody is a highly reactive monoclonal antibody that targets the growth factor histidine. It is specifically designed to bind to collagen and epidermal growth factor, making it an effective tool for research in the field of Life Sciences. Additionally, this antibody has shown strong binding affinity towards anti-mesothelin, TGF-beta1, steroid, erythropoietin, and glutamate. With its ability to detect and neutralize autoantibodies, the BAK antibody is an invaluable asset for any laboratory or research facility. Trust in its reliability and specificity to enhance your experiments and advance scientific knowledge.</p>

<p>Salmonella typhi Monoclonal Antibody BSA/Azide Free</p>

<p>The CES2 antibody is a polyclonal antibody that is used in immunohistochemistry to detect the presence of CES2 antigen. It can be immobilized on an electrode and activated to bind specifically to CES2 antigen. This antibody has been shown to have high specificity and sensitivity in detecting CES2 expression in various tissues. CES2 is an enzyme that plays a crucial role in drug metabolism, including the activation of prodrugs and the detoxification of xenobiotics. It has also been implicated in interferon signaling and chemokine regulation. The CES2 antibody is widely used in life sciences research to study the function and localization of CES2 protein in different biological systems, including transthyretin-related diseases and CXCR4-mediated processes.</p>

<p>1-134 amino acids: MGSSHHHHHH SSGLVPRGSH MEFVMKQALG GATKDMGKML GGDEEKDPDA AKKEEERQEA LRQAEEERKA KYAKMEAERE AVRQGIRDKY GIKKKEEREA EAQAAMEANS EGSLTRPKKA IPPGCGDEVE EEDESILDTV IKYLPGPLQD MLKK</p>

<p>Purified Polyclonal GPR182 antibody</p>

<p>Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA</p>

<p>Purified Polyclonal Kallikrein 3 antibody</p>