Produits biochimiques et réactifs

<p>INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK</p>

<p>Rabbit polyclonal GSDMC antibody</p>

<p>Armenian Hamster monoclonal gamma delta TCR antibody (allophycocyanin)</p>

<p>Purified recombinant PSMD9 protein</p>

<p>UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV</p>

<p>Rabbit polyclonal BIM antibody (Ser59)</p>

<p>NOTCH1 antibody was raised in rabbit using the middle region of NOTCH1 as the immunogen</p>

<p>Cystatin S protein is a factor-α that plays a crucial role in inhibiting proteases, which are enzymes responsible for breaking down proteins. This protein can be conjugated with other molecules to enhance its functionality. Monoclonal antibodies specific to Cystatin S protein have been developed and can be used for research purposes. Cystatin S protein has been shown to inhibit the activity of glial fibrillary acidic protein, which is involved in the formation of glial cells in the central nervous system. It also has an inhibitory effect on interleukin-6, a cytokine involved in inflammation. Studies have demonstrated that Cystatin S protein can bind to cellulose, suggesting potential applications in the field of biomaterials. Additionally, it has been found to have reactive properties against interferon and exhibits neutralizing effects on certain factors present in human serum and adipose tissue.</p>

<p>SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR</p>

<p>NPFF1 antibody was raised in rabbit using N terminal sequence MEGEPSQPPNSSWPLS and C terminal sequence CSHLPLTIPAWDI of the human NPFF1 protein as the immunogen.</p>

<p>ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA</p>

<p>Rabbit polyclonal GBA3 antibody</p>

<p>The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.</p>

<p>Rabbit polyclonal STXBP4 antibody</p>

<p>ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF</p>

<p>SH3GL2 antibody was raised using the N terminal of SH3GL2 corresponding to a region with amino acids INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA</p>

<p>EDTA plasma is a type of sample used in Life Sciences research and drug development. It contains inhibitors, such as teriparatide and TNF-α neutralizing agents, which are commonly used in experiments involving drug antibodies. EDTA plasma is particularly useful for studying fibrinogen levels, monoclonal antibodies, and binding proteins. In research settings, EDTA plasma is often employed to measure phosphatase activity and evaluate the effects of alpha-gal antibodies. This type of plasma is widely used in Biospecimen studies as it allows for the analysis of various biomarkers, including those found in human serum and other bodily fluids. Overall, EDTA plasma serves as a valuable resource for scientists and researchers looking to study the intricate details of biological processes and develop new therapies or diagnostic tools. Its unique composition enables accurate measurements and precise analysis, making it an essential component in many scientific investigations.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>The mTOR antibody is a highly specialized monoclonal antibody that targets the phosphatase known as mammalian target of rapamycin (mTOR). This glycoprotein plays a crucial role in regulating cell growth, proliferation, and survival. By specifically binding to mTOR, this antibody inhibits its activity and disrupts downstream signaling pathways involved in cell cycle progression and protein synthesis.</p>

<p>GIPC2 antibody was raised in Rabbit using Human GIPC2 as the immunogen</p>

<p>MITD1 antibody was raised in Rabbit using Human MITD1 as the immunogen</p>

<p>The PCT monoclonal antibody is a neutralizing protein used in the field of Life Sciences. It is an antibody that specifically targets and binds to urokinase plasminogen activator (uPA), inhibiting its activity. By blocking uPA, this antibody helps regulate thrombocytopenia, a condition characterized by low platelet levels. Additionally, the PCT monoclonal antibody exhibits cytotoxic effects on cells expressing high levels of uPA, making it a potential therapeutic option for certain diseases. This monoclonal antibody can also be used in research settings to study the role of uPA in various biological processes and as a diagnostic tool to measure uPA levels in patient samples. With its ability to target and modulate the activity of this important growth factor, the PCT monoclonal antibody holds promise as a medicament for various conditions involving aberrant uPA signaling pathways.</p>

<p>Purified recombinant ANKRD54 protein (His tag)</p>

<p>DBP antibody was raised in mouse using recombinant Albumin D-Box Binding Protein</p>

<p>GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>Purified recombinant JAK2 protein (His tag)</p>

<p>Mouse monoclonal Notch 1 antibody (PE)</p>

<p>PNMT antibody was raised in guinea pig using phenylethanolamine-N-methyltransferase from bovine adrenal medulla as the immunogen.</p>

<p>Purified recombinant SEP15 protein (His tag)</p>

<p>Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT</p>

<p>Rabbit polyclonal SNRPF antibody</p>

<p>The WDR1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to WDR1, a protein involved in growth factor signaling pathways. By neutralizing the activity of WDR1, this antibody can inhibit the growth and proliferation of cells.</p>

<p>LPCAT1 antibody was raised in Rabbit using Human LPCAT1 as the immunogen</p>

<p>Rabbit polyclonal RPL7 antibody</p>

<p>The GLUR2 antibody is a monoclonal antibody that has been developed to target atypical hemolytic. It specifically binds to low-density lipoprotein receptor-related protein 2 (GLUR2) and inhibits its protease activity. This antibody can be used in various life science applications, including research on epidermal growth factor and other growth factors. Additionally, the GLUR2 antibody can also be used to study autoantibodies and nuclear antibodies. It is a valuable tool for researchers in the field of life sciences and can be used in conjunction with other inhibitors or monoclonal antibodies such as trastuzumab.</p>

<p>MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI</p>

<p>The CYP17A1 antibody is a monoclonal antibody that is designed to specifically target and bind to the CYP17A1 enzyme. This enzyme plays a crucial role in the biosynthesis of steroid hormones, making it an important target for research in the field of Life Sciences. The CYP17A1 antibody has been extensively validated and proven to have high specificity and sensitivity in detecting and quantifying CYP17A1 levels.</p>

<p>Purified Polyclonal EPHB6 antibody</p>

<p>Rabbit Polyclonal USP3 antibody</p>

<p>Mouse monoclonal POLR2J2 antibody</p>

<p>Prealbumin antibody was raised against Human Prealbumin.</p>

<p>Rabbit polyclonal UBE2A antibody</p>

<p>Mouse monoclonal RhoGDI antibody</p>

<p>Estriol 6-CMO is a carbonic antiviral compound that exhibits inhibitory activity against tumor necrosis factor-alpha (TNF-α) and other growth factors, such as transforming growth factor-beta (TGF-beta). It has been shown to interact with proteins and antigens, including adalimumab, an immunosuppressive monoclonal antibody. Estriol 6-CMO also demonstrates neutralizing effects on interferon and epidermal growth factor. Additionally, it has been found to inhibit the chemokine response in pneumococcus infections. With its broad range of activities, Estriol 6-CMO shows promise as a potential therapeutic agent for various viral and inflammatory conditions.</p>

<p>Purified recombinant BABAM1 protein (His tag)</p>

<p>CD72 antibody was raised in rabbit using residues 305-317 [KDWKLTDDTQRTRI] of the 42 kDa human CD72 protein as the immunogen.</p>

<p>ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen</p>

<p>Rabbit polyclonal RPL17 antibody (HRP)</p>

<p>Rabbit polyclonal ZNF193 antibody</p>

<p>Purified Rabbit polyclonal CHST2 antibody</p>

<p>Rabphilin 3A antibody is a polyclonal antibody that is used in the field of Life Sciences. It plays a crucial role in melanogenesis and has anti-VEGF (vascular endothelial growth factor) properties. This antibody is highly specific and can bind to various binding proteins, growth factors, hormone peptides, and cytotoxic antigens. It has been extensively studied for its effectiveness in immunoassays and antigen-antibody reactions. Rabphilin 3A antibody has shown promising results in targeting HL-60 cells and has also been used in combination with anti-CD33 antibodies for therapeutic purposes. With its wide range of applications, this antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>IFN gamma antibody is a glycoprotein that belongs to the family of interferons. It is a monoclonal antibody used in Life Sciences research for its ability to neutralize IFN-gamma, an important cytokine involved in immune responses. This antibody specifically binds to IFN-gamma and prevents its interaction with cell surface receptors, thereby inhibiting its signaling pathway. The binding of IFN gamma antibody to IFN-gamma can also lead to the formation of dimers or complexes, which further enhances its neutralizing activity. Additionally, this antibody has been shown to have potential therapeutic applications in viral infections, as it can target virus surface antigens and inhibit their function. Its specificity and high affinity make it a valuable tool for studying the role of IFN-gamma in various biological processes.</p>

<p>HAPLN4 antibody was raised in Rabbit using Human HAPLN4 as the immunogen</p>

<p>The CD29 antibody is a monoclonal antibody that has neutralizing properties. It is used in various life sciences applications, including immunoassays and antigen-antibody reactions. This antibody specifically targets CD29, a cell surface protein found on cardiomyocytes and other cell types. By inhibiting the interaction between CD29 and its ligands, the CD29 antibody can modulate cellular processes such as adhesion, migration, and signaling. In addition to its role in research, this antibody may have potential therapeutic applications in conditions involving abnormal CD29 activity or expression. The CD29 antibody is highly specific and reliable, making it an essential tool for scientists and researchers in the field of molecular biology.</p>

<p>TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA</p>

<p>The TAGLN antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and detect TAGLN, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting TAGLN in atherosclerotic plaques, making it a valuable tool for researchers studying cardiovascular diseases.</p>

<p>Rabbit anti-Human Inhibin beta chain protein antibody</p>

<p>IAPP antibody was raised in rabbit using the N terminal of IAPP as the immunogen</p>

<p>The GAK antibody is a growth factor that has various applications in the field of Life Sciences. It is commonly used in immunoassays and research studies. This antibody, available as both polyclonal and monoclonal forms, targets specific proteins involved in cellular processes such as phosphatase activity, collagen production, and fibronectin binding. By binding to these proteins, the GAK antibody can modulate their functions and provide valuable insights into cell signaling pathways. Additionally, this antibody has been studied for its potential therapeutic use as a medicament in targeting tyrosine kinase receptors and adeno-associated virus (AAV) activated pathways. With its versatility and wide range of applications, the GAK antibody is an essential tool for researchers in the Life Sciences field.</p>

<p>Purified recombinant PRPSAP2 protein (His tag)</p>

<p>Glucagon receptor antagonists II are a class of drugs that inhibit the activity of glucagon receptors. These drugs have been shown to increase blood glucose levels in patients with type 2 diabetes and bowel disease. Glucagon receptor antagonists II bind to the glucagon receptor and block the binding of glucagon, preventing it from activating its downstream signaling pathways. The activation of these pathways leads to elevated blood glucose levels, which can be beneficial for patients with type 2 diabetes. Glucagon receptor antagonists II are currently being studied for potential applications in inflammatory bowel disease, obesity, and insulin resistance.</p>

<p>Perforin antibody (FITC) was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.</p>

<p>HCV NS5 immunodominant regions of Hepatitis C Virus protein containing amino acids 2322-2423.</p>

<p>Mouse IgG1 kappa light chain antibody (biotin) was raised in rat using murine IgG kappa as the immunogen.</p>

<p>Please enquire for more information about Senazodan including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse IgG1 heavy chain antibody (biotin) was raised in rat using murine IgG1 as the immunogen.</p>

<p>Potent and selective allosteric LIMK 1/2 inhibitor</p>

<p>GW 766994 is a synthetic chemokine that binds to chemokine receptors and activates them. It has been shown to activate the CCR1 receptor, which is found in human eosinophils. This agent also has been shown to reduce neovascularization and structural damage to the heart by preventing the release of pro-inflammatory cytokines. GW 766994 is a potent inhibitor of inflammatory diseases such as rheumatoid arthritis, Crohn's disease, and psoriasis. It also has been shown to inhibit the production of glucosaminoglycan in cartilage cells. GW 766994 has been shown to be active in animal models for various diseases including asthma, collagen-induced arthritis, colitis, and type 1 diabetes mellitus.</p>

<p>LT052 is a research tool, activator, ligand and receptor. It is used in cell biology to study the interaction of proteins with antibodies or peptides. LT052 is also used in pharmacology to study protein interactions with ion channels and ion-channel blockers. This product has been shown to inhibit the binding of calcium ions to the nicotinic acetylcholine receptor, which may be useful for treating conditions such as Alzheimer's disease, schizophrenia, and epilepsy.</p>

<p>Please enquire for more information about CMP-5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ML233 is a molecule that has been shown to have stem cell-like properties. It has been shown to promote the regeneration of retinal neurons and ganglion cells, preventing neuronal death in animal models with ischemia reperfusion injury. ML233 has also been shown to inhibit the proliferation of cancer cells and reduce inflammation in animal models. This molecule is conjugated to an antigen or antibody and administered intravitreally, where it can be delivered directly to the retina without entering systemic circulation.</p>

<p>2-[[5-[4-(Dimethylsulfamoyl)phenyl]-8-methyl-2-oxo-1,6,7,9-tetrahydropyrrolo[3,2-H]isoquinolin-3-ylidene]amino]oxy-4-hydroxybutanoic acid is a synthetic isoquinoline derivative, often investigated in the field of medicinal chemistry and cancer pharmacology. This compound is typically synthesized through complex organic reactions involving the modification of isoquinoline skeletons, commonly used as scaffolds for designing biologically active molecules.</p>

<p>Portion of Influenza NP</p>

<p>PROTAC CDK9 Degrader-1 is a combination therapy that includes two different types of drugs. One drug inhibits the activity of cyclin-dependent kinases (CDKs). The other drug inhibits the activity of autophagy enzymes. Together, these drugs inhibit the growth of cancer cells and are currently being investigated as a treatment for leukemia and lymphoma in human patients.</p>

<p>Frequentin is a peptide that is used as a research tool to study protein interactions and protein-protein interactions. It has been shown to inhibit the activity of ion channels such as nicotinic acetylcholine receptor (nAChR) and potassium channels. Frequentin also inhibits the binding of ligands to their receptors, including glutamate and GABA. This peptide can be used in pharmacological studies for its ability to bind to proteins, but it cannot be used therapeutically because it is rapidly degraded by proteases.</p>

<p>Apadenoson-d5 is a synthetic ligand for the beta 2 adrenergic receptor, a protein that regulates the rate of cellular metabolism and the release of hormones. It has been shown to bind to both rat and human beta 2 adrenergic receptors with high affinity. Apadenoson-d5 has also been shown to inhibit the function of adenylate cyclase, an enzyme involved in the production of cAMP, which is important for many cell functions including signaling. Apadenoson-d5 may be used as a research tool or pharmacological agent.</p>

<p>SHR0302 is a peptide that activates the G protein-coupled receptor. It has been shown to inhibit protein interactions with the receptor and is used as a research tool to study the cell biology of ion channels. SHR0302 is a potent inhibitor of ligand binding to its receptor, which may be due to its conformational flexibility and ability to bind at different sites on the ligand.<br>SHR0302 can also be used as an antibody for immunohistochemical detection of the receptor in tissue sections. SHR0302 has a molecular weight of 2,867 g/mol and CAS number 1445987-21-2.</p>

<p>TNF-± Antagonist III is a drug that is used to inhibit the production of TNF-α. It has been shown to regulate transcriptional activity in cells and to inhibit the growth of cancer cells. TNF-± Antagonist III has been observed to decrease the M2 phenotype, which may be due to its ability to activate ATP levels in macrophages. This drug also inhibits kidney fibrosis by reducing pro-inflammatory factors, such as tumor necrosis factor-α (TNF-α) and fatty acids. The drug also has effects on abdominal surgery, as it reduces inflammation following this type of procedure. TNF-± Antagonist III is used in fat tissue and adipose tissue, where it reduces the number of pro-inflammatory factors produced by macrophages.</p>

<p>Combretastatin A-1 Phosphate is a peptide inhibitor that binds to the receptor of protein kinase C and inhibits its activity. This drug is a potent activator of G proteins and has been used as a research tool in cell biology. It has been shown to inhibit ion channels and activate ligand-gated ion channels, which may be beneficial in the treatment of hypertension. Combretastatin A-1 Phosphate is also an excellent reagent for labeling antibodies with radioactive iodine, which can be used for immunohistochemistry assays.</p>

<p>Please enquire for more information about 1-Methyl-4-phenyl-3-(1H-pyrrol-1-yl)-1H-pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Topfluor PI(4,5)P2 is a synthetic phosphoinositide, which is chemically modified to include a fluorophore for advanced biological research. It is derived from phosphatidylinositol 4,5-bisphosphate, a critical lipid found in eukaryotic cell membranes. The fluorophore allows researchers to visualize and track the behavior of phosphoinositides in real-time using fluorescence microscopy techniques.</p>

<p>Clotrimatrozole imp B ep is a peptide that is used as a research tool for the study of ion channels and protein interactions. It has been shown to function as an inhibitor of potassium ion channels, which are important in the regulation of nerve and muscle function. Clotrimatrozole imp B ep binds to the extracellular receptor-binding domain (ECD) of its target protein, thereby inhibiting its interaction with ligands or other proteins. Clotrimatrozole imp B ep also inhibits protein interactions with membrane-bound receptors, such as G-protein coupled receptors (GPCRs). This inhibition can be blocked by adding an antibody that binds to the ECD domain.</p>

<p>2-Methyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]-5-(trifluoromethyl)quinazolin-4-one is a potent and selective inhibitor of the type I phosphodiesterase (PDE1). It has been shown to inhibit PDE1 in human platelets and erythrocytes. It also inhibits the activation of protein kinase C by thrombin. This agent binds to a region on PDE1 that does not overlap with the binding site for most PDE inhibitors, suggesting that it may be useful as an alternative treatment for conditions such as asthma and inflammation.</p>

<p>µ- and Ύ-opioid receptor antagonist; antidote for opioid overdose</p>

<p>Please enquire for more information about c18 D-Threo ceramide (d18:1/18:0) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Biocytin is a naturally occurring biogenic amine. It is one of the major metabolic products of tryptophan, and can be found in many tissues and body fluids. Biocytin is an important intermediate in the synthesis of catecholamines from tyrosine, as well as in the synthesis of dopamine from l-DOPA. It is also a precursor to other biologically active molecules such as serotonin and melatonin. Biocytin has been shown to have a role in axonal growth, and may play a role in various neurological disorders such as metabolic disorders or hippocampal formation. Biocytin can also be used for analytical purposes due to its ability to bind proteins.</p>

<p>BMS-687453 is an amide compound that inhibits the activity of creatine kinase and targets the expression of genes involved in lipid metabolism. It has been shown to be effective in treating type 2 diabetes by lowering blood sugar levels. BMS-687453 also reduces serum urea nitrogen and phenylpropionic acid, which are metabolites of amino acids. BMS-687453 can activate low-density lipoprotein cholesterol, thereby reducing the risk of atherosclerosis. It is also an inhibitor of diabetic neuropathy and it has been shown to reduce pain perception in animal models. The mechanism by which BMS-687453 reduces pain may be due to its ability to inhibit the production and release of inflammatory cytokines such as TNF-α and IL-1β through activation of nuclear hormone receptors.</p>

<p>CM-4620 is a small molecule that has shown to inhibit the replication of picornaviruses, such as co-virus 19, by binding to their cytosolic CA2+ channels. This inhibits the release of cellular calcium ions, which leads to the inhibition of virus replication. CM-4620 is being evaluated in clinical trials for its ability to treat pancreatitis and other diseases caused by picornaviruses. The pharmacokinetic properties and safety profile of CM-4620 have been studied in detail.</p>

<p>GR127935 is a small-molecule, high-quality peptide that belongs to the class of activators. It is a ligand that binds to the receptor and increases the affinity of the receptor for its natural ligand. GR127935 has been shown to activate ion channels by binding to the receptor. This compound is used in research as an inhibitor or as a tool to study protein interactions.<br>GR127935 interacts with many different receptors, including those for dopamine, acetylcholine, serotonin, and histamine. It also binds to nicotinic acetylcholine receptors (nAChRs), which are found in muscle cells and are important for movement.</p>

<p>MSG 606 is a mitochondrial fission inhibitor that has been shown to reduce microglial activation, neuroinflammation and the release of neutrophils from the bone marrow. This drug also has neuroprotective properties and can be used for treatment of neurodegenerative disorders. MSG 606 is an investigational drug, not approved for human use.</p>

<p>4-Chloro-N-(2-morpholin-4-ylcyclohexyl)benzenesulfonamide is a potent and selective inhibitor of the N-type voltage gated calcium channels. It has been shown to inhibit the activity of these channels in cell culture, and may be useful as a research tool for studying ion channel function.</p>

<p>Please enquire for more information about (R)-Rexamino including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DAMGO is a synthetic opioid drug that is used in scientific research to study the effects of opioids on cell membrane excitability. DAMGO binds to the δ-opioid receptor, which is found in high concentrations in the central nervous system and small intestine. It has a synergistic effect with other drugs, such as naloxone, that block the μ-opioid receptor. In vivo studies have shown that DAMGO induces significant upregulation of energy metabolism genes in squamous epithelial cells, and this upregulation is synergic with naloxone.</p>

<p>BTTAA is water-soluble accelerating ligand for CuAAC that provides much greater rate enhancement compared to previous generation ligands (e.g. THPTA or TBTA).</p>

<p>Utibapril inhibits the activity of angiotensin-converting enzyme (ACE), an enzyme that breaks down the hormone angiotensin I. This leads to an increase in the levels of angiotensin II, which causes blood vessels to narrow by activating a G protein and stimulating the release of a second messenger, nitric oxide. Utibapril is used as a treatment for hypertension, congestive heart failure, and other cardiovascular disorders. It has been shown to cause insulin resistance in patients with type 2 diabetes mellitus and metabolic syndrome. The long-term use of utibapril may lead to congestive heart failure due to its effect on lipid metabolism.</p>

<p>Please enquire for more information about Kcc2 blocker 1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ZD 7114 hydrochloride is a drug that activates the PPAR-α receptor. It has been shown to increase glucose uptake in the adipose tissue of mice and increase insulin sensitivity, which may be due to its ability to decrease fatty acid synthesis. ZD 7114 hydrochloride also increases lipid catabolism in the liver and adipose tissue, leading to weight loss. ZD 7114 hydrochloride also has an effect on body temperature, increasing heat production by up to 13%.</p>

<p>Itraconazole-d5 is a fluorescent derivative of itraconazole that is used for the detection of eosinophil cationic protein in the diagnosis of asthma. It binds to wild-type strains and inhibits fungal enzyme activities, such as concentration–time curves and minimal toxicity. The hydrogen bonding interactions between itraconazole-d5 and its target molecule are stronger than those between itraconazole and its target molecule. Itraconazole-d5 has been shown to inhibit the production of cationic proteins by inhibiting the activity of enzymes, such as polymerase chain reaction (PCR) and reverse transcriptase (RT), which are required for DNA synthesis.</p>

<p>Cyprodinil-13C6 is a cationic compound that has been shown to activate IL-17A, an important cytokine involved in immune responses. It exhibits a unique coordination geometry and forms complex molecules with malondialdehyde, a reactive aldehyde. In the field of Life Sciences, Cyprodinil-13C6 has been extensively studied for its ability to neutralize chemokines and inhibit lipid peroxidation. It has also been found to have a protective effect on inositol and reactive oxygen species in human serum. With its diverse range of properties, Cyprodinil-13C6 holds great potential for various applications in research and development.</p>

<p>Dopropidil is a pharmaceutical preparation that is a fatty alcohol. It is used as an implanting agent and in the production of pharmaceutical dosage forms. Dopropidil has been shown to be effective in experimental models of inflammation, but it has not been studied in humans.</p>