Produits biochimiques et réactifs

<p>Mouse monoclonal MAPK7 antibody</p>

<p>CTCF antibody was raised in Rat using Mouse CTCF-N-terminal fragment as the immunogen.</p>

<p>Purified Polyclonal Nibrin antibody</p>

<p>IgG2b antibody was raised in Mouse using Rat IgG2b as the immunogen.</p>

<p>SFXN4 antibody was raised in rabbit using the N terminal of SFXN4 as the immunogen</p>

<p>The RPA2 antibody is a highly specialized monoclonal antibody that has been extensively studied for its therapeutic potential in various conditions. It specifically targets calmodulin, a protein involved in many cellular processes. The RPA2 antibody has shown promising results in the treatment of heparin-induced thrombocytopenia, a condition characterized by low platelet count due to an immune reaction to heparin.</p>

<p>Recombinant Human FOLR1 protein (His tag)</p>

<p>Goat anti-human IgG (H+L) (biotin) was raised in goat using human IgG, whole molecule as the immunogen.</p>

<p>Rabbit polyclonal DsbAL antibody</p>

<p>The TK antibody is a monoclonal antibody that specifically binds to TK (Thymidine Kinase), a protein involved in DNA synthesis. It is commonly used in research and diagnostic applications to detect the presence of TK or to study its function. The TK antibody can be used in various immunoassays, such as ELISA or Western blotting, to accurately measure the levels of TK in samples. This antibody has high specificity and sensitivity, making it an ideal tool for researchers in the field of Life Sciences. Additionally, the TK antibody can also be used for therapeutic purposes, targeting specific receptors or antigens associated with diseases such as cancer. Its binding properties allow for precise targeting and potential treatment options. With its robust binding capabilities and wide range of applications, the TK antibody is an essential tool for scientists and clinicians alike.</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>CDH4 antibody was raised in Rabbit using Human CDH4 as the immunogen</p>

<p>Rabbit polyclonal COX5A antibody (FITC)</p>

<p>VWF antibody was raised in sheep using Rat vWF purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TH antibody, catalog no. 70R-7854</p>

<p>GORASP1 antibody was raised in rabbit using the N terminal of GORASP1 as the immunogen</p>

<p>Rabbit polyclonal CDKA2 antibody</p>

<p>Mouse monoclonal SIL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAT1 antibody, catalog no. 70R-4703</p>

<p>Rabbit polyclonal Seed G35 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ard1b antibody, catalog no. 70R-8794</p>

<p>Purified Polyclonal PIAS3 antibody</p>

<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK</p>

<p>The CD71 antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody specifically targets the CD71 molecule, also known as transferrin receptor 1. It plays a crucial role in iron metabolism and is highly expressed on the surface of proliferating cells.</p>

<p>The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.</p>

<p>EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ</p>

<p>Recombinant Human EDN3 protein (His tag)</p>

<p>HSPB1 antibody was raised in rabbit using the C terminal of HSPB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TLR2 antibody, catalog no. 33R-11063</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Extensive research using a patch-clamp technique on human erythrocytes has demonstrated its high efficacy in human subjects. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>MLXIPL antibody was raised in Rabbit using Human MLXIPL as the immunogen</p>

<p>Rabbit polyclonal SH3GLB1 antibody</p>

<p>Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE</p>

<p>Purified Polyclonal MKK1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM141 antibody, catalog no. 70R-10161</p>

<p>ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL4 antibody, catalog no. 70R-3191</p>

<p>ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen</p>

<p>WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI3 antibody, catalog no. 70R-9627</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS</p>

<p>The FSHR antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target the follicle-stimulating hormone receptor (FSHR). This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Mouse monoclonal CISD1 antibody</p>

<p>The TOP2B antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of TOP2B, an enzyme involved in DNA replication and repair. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to effectively inhibit the activity of TOP2B in nuclear extracts and interfere with its function. Additionally, this antibody has been found to enhance the effects of interferon and trastuzumab, an anti-HER2 antibody. Its unique properties make it a valuable tool for researchers studying epidermal growth factor signaling, androgen receptor function, and other growth factor pathways. The TOP2B antibody is available for purchase and comes with detailed instructions for use.</p>

<p>Mouse monoclonal UBL4A antibody</p>

<p>Methandriol 3b Conjugate for use in immunoassays</p>

<p>Purified Polyclonal CYSLTR1 antibody</p>

<p>Purified recombinant Human STAMBPL1 protein (His tag)</p>

<p>Myoglobin antibody was raised in rabbit using human heart derived myoglobin as the immunogen.</p>

<p>Purified Polyclonal MAGEA6 antibody</p>

<p>MGNSKSGALS KEILEELQLN TKFSEEELCS WYQSFLKDCP TGRITQQQFQ SIYAKFFPDT DPKAYAQHVF RSFDSNLDGT LDFKEYVIAL HMTTAGKTNQ KLEWAFSLYD VDGNGTISKN EVLEIVMAIF KMITPEDVKL LPDDENTPEK RAEKIWKYFG KNDDDKLTEK EFIEGTLANK EILRLIQFEP QKVKEKMKNA</p>

<p>The Synaptotagmin antibody is a highly specialized globulin that is used in various research and medical applications. This antibody specifically targets and neutralizes synaptotagmin, a protein involved in neurotransmitter release at the synapse. It has been extensively studied and characterized for its ability to inhibit lipoprotein lipase activity, making it an important tool in lipid metabolism research.</p>

<p>BACE2 antibody was raised in Rabbit using Human BACE2 as the immunogen</p>

<p>BRSV antibody was raised in rabbit using residues 201-211 [KELLPKVNNHDC] of the 63 kDa BRSV F protein as the immunogen.</p>

<p>Myoglobin protein is a high-quality monoclonal antibody that belongs to the category of Native Proteins &amp; Antigens. It is specifically designed for use in various applications, including electrode development and human serum analysis. This protein exhibits exceptional binding affinity towards lipoprotein lipase, transferrin, alpha-fetoprotein, and interferon. With its high specific activity and low density, Myoglobin protein provides accurate and reliable results in Life Sciences research. Additionally, its glycan structure allows for enhanced stability and functionality. Trust Myoglobin protein to deliver precise and consistent data for your scientific endeavors.</p>

<p>GSDMB antibody was raised in Rabbit using Human GSDMB as the immunogen</p>

<p>C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL</p>

<p>Mouse monoclonal IRF2 antibody</p>

<p>The eEF2 antibody is a monoclonal antibody that targets and binds to the eukaryotic elongation factor 2 (eEF2). This antibody plays a crucial role in cholinergic and dopamine signaling pathways. It has been extensively used in research within the field of Life Sciences to study the function and regulation of eEF2.</p>

<p>LRRC1 antibody was raised in Rabbit using Human LRRC1 as the immunogen</p>

<p>CK1 delta antibody was raised in goat using residues 310-327 of human casein kinase 1d located at the C-terminus as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB4 antibody, catalog no. 70R-4586</p>

<p>KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY</p>

<p>Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI</p>

<p>Mouse monoclonal KDM3A antibody</p>

<p>The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets histone H3, a protein involved in the regulation of gene expression and chromatin structure. This antibody has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and chromatin immunoprecipitation.</p>

<p>The CNN2 antibody is a highly specialized monoclonal antibody that targets the CNN2 protein. This protein is involved in various cellular processes, including glycosylation and mineralization. It plays a crucial role in human folate metabolism and growth factor signaling. The CNN2 antibody specifically binds to the collagen domain of the CNN2 protein, blocking its activity and preventing downstream effects.</p>

<p>PKR antibody is a specific antibody used in Life Sciences for various applications. It can be utilized as a vaccine adjuvant composition, enhancing the immune response to vaccines. This monoclonal antibody has been extensively studied and proven effective in phenotypic assays, such as intravascular hemolysis. Additionally, it has shown promising results in the development of recombinant vaccinia-based anticancer agents.</p>

<p>EB2 antibody was raised in Rat using Mouse EB2 fused to GST as the immunogen.</p>

<p>Purified native Chicken Troponin I protein (Skeletal Muscle)</p>

<p>MORF4L2 antibody was raised in Rabbit using Human MORF4L2 as the immunogen</p>

<p>The CTLA4 antibody is a glycoprotein that acts as a kinase inhibitor. It belongs to the class of monoclonal antibodies and is commonly used in the treatment of various diseases, including cancer and autoimmune disorders. This antibody specifically targets CD20, a protein expressed on the surface of certain cells, including B lymphocytes. By binding to CD20, the CTLA4 antibody activates immune responses against these cells, leading to their destruction.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BBS2 antibody, catalog no. 70R-9878</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYDE1 antibody, catalog no. 70R-3763</p>

<p>RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV</p>

<p>1-131 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMCF PKVLSDDMKK LKARMHQAIE RFYDKMQNAE SGRGQVMSSL AELEDDFKEG YLETVAAYYE EQHPELTPLL EKERDGLRCR GNRSPVPDVE DPATEEPGES FCDKSYGAPR GDKEELTPQK CSEPQSSK</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Rabbit polyclonal GATA2 antibody (Ser401)</p>

<p>The PTGER2 antibody is an inhibitor that specifically targets the PTGER2 protein, which is involved in various cellular processes. It is commonly used as a research tool to study the function and regulation of PTGER2. This antibody has been shown to be effective in blocking the activity of PTGER2 in various assays, including chloride secretion assays and interferon-stimulated gene expression assays. Additionally, it has been used to detect the presence of PTGER2 in serum samples, making it a valuable serum marker for certain diseases. The PTGER2 antibody is a polyclonal antibody that has been extensively tested and validated for its specificity and sensitivity. Its high-flux binding capacity ensures accurate and reliable results in experimental settings. Whether you are conducting research or developing new therapeutic strategies, the PTGER2 antibody is an essential tool for studying PTGER2-related pathways and mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS6KA2 antibody, catalog no. 70R-5759</p>

<p>Rabbit polyclonal SYMPK antibody</p>

<p>Affinity purified Rabbit polyclonal TMEM59 antibody</p>

<p>Acepromazine Maleate (USP grade powder) chemical reference substance</p>

<p>IL9 antibody was raised in Rabbit using Human IL9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNAB2 antibody, catalog no. 70R-1486</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>Purified recombinant CXCL9 protein (His tag)</p>

<p>The CD11b antibody is a highly specific monoclonal antibody that targets the CD11b protein. This protein is involved in various cellular processes, including cell adhesion and migration. The CD11b antibody has been extensively studied for its inhibitory effects on the 5-ht1a serotonin receptor, which plays a crucial role in neurotransmission.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-7369</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPO antibody, catalog no. 70R-10209</p>

<p>Exodus 2 antibody was raised in rabbit using highly pure recombinant murine exodus-2 as the immunogen.</p>

<p>CACNB2 antibody was raised using the N terminal of CACNB2 corresponding to a region with amino acids MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYT</p>

<p>Rabbit polyclonal SGOL1 antibody</p>

<p>USP26 antibody was raised in rabbit using the middle region of USP26 as the immunogen</p>

<p>Purified Polyclonal RPL36 antibody</p>

<p>Mouse monoclonal PIH1D2 antibody</p>

<p>Purified Polyclonal ELOF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1B1 antibody, catalog no. 70R-3238</p>

<p>Purified recombinant GCAT protein (His tag)</p>

<p>EPB49 antibody was raised in rabbit using the middle region of EPB49 as the immunogen</p>