Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.205 produits)
- Par Biological Target(99.900 produits)
- Par usage/effets pharmacologiques(6.790 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.835 produits)
- Métabolites secondaires(14.345 produits)
130607 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
IL9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL9 antibody, catalog no. 70R-6234</p>Degré de pureté :Min. 95%Beflubutamid-M
CAS :Beflubutamid-M is a potent kinase inhibitor that has been shown to inhibit the growth of cancer cells in vitro. It is an analog of other inhibitors that have been used in Chinese medicinal practices for centuries. Beflubutamid-M has been found to induce apoptosis in various cancer cell lines, including leukemia, by inhibiting the activity of certain proteins involved in tumor growth and proliferation. This drug has also been detected in human urine following administration, indicating its potential for use as a therapeutic agent against cancer. Its unique mechanism of action makes it a promising candidate for further development as an anti-cancer drug.Formule :C18H17F4NO2Degré de pureté :Min. 95%Masse moléculaire :355.3 g/molGABARAPL2 antibody
<p>GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV</p>STX2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX2 antibody, catalog no. 70R-10264</p>Degré de pureté :Min. 95%MKK4 antibody
<p>The MKK4 antibody is a highly specific monoclonal antibody that is widely used in the field of Life Sciences. It has been extensively studied and proven to be effective in various research applications. The antibody is designed to target and bind to MKK4, a protein involved in signal transduction pathways.</p>Basic hair keratin K82 antibody
<p>basic hair keratin K82 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K82 coupled to KLH as the immunogen.</p>Degré de pureté :Min. 95%APRT antibody
<p>APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK</p>G6PD antibody
<p>G6PD antibody was raised using the middle region of G6PD corresponding to a region with amino acids VTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRI</p>CRAT Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRAT antibody, catalog no. 70R-1945</p>Degré de pureté :Min. 95%MGC50273 antibody
<p>MGC50273 antibody was raised using the N terminal of MGC50273 corresponding to a region with amino acids MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE</p>ZNF547 antibody
<p>ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogen</p>Degré de pureté :Min. 95%CALCR antibody
<p>CALCR antibody was raised in rabbit using the C terminal of CALCR as the immunogen</p>Degré de pureté :Min. 95%FIIN-1
CAS :<p>FIIN-1 is a non-selective inhibitor of the epidermal growth factor receptor (EGFR). It binds to the EGFR and prevents it from binding with its ligands. This inhibition of EGFR prevents cellular proliferation, which can lead to cancer. FIIN-1 also inhibits the tyrosine kinase activity of the EGFR and therefore inhibits the phosphorylation of proteins that regulate cell growth. FIIN-1 is effective at inhibiting platelet-derived growth factors, such as PDGF, and other growth factors, such as EGF. The binding of FIIN-1 to the EGFR has been shown to inhibit tumor cell proliferation in vitro and in vivo.</p>Formule :C32H39Cl2N7O4Degré de pureté :Min. 95%Masse moléculaire :656.6 g/molIFN gamma 1 protein
<p>Region of IFN Gamma protein corresponding to amino acids PTSKPTTTGK GCHIGRFKSL SPQELASFKK ARDALEESLK LKNWSCSSPV FPGNWDLRLL QVRERPVALE AELALTLKVL EAAAGPALED VLDQPLHTLH HILSQLQACI QPQPTAGPRP RGRLHHWLHR LQEAPKKESA GCLEASVTFN LFRLLTRDLK YVADGNLCLR TSTHPEST.</p>Degré de pureté :Min. 95%SOX13 antibody
<p>The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.</p>WNT10B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT10B antibody, catalog no. 70R-5288</p>Degré de pureté :Min. 95%ACSL5 antibody
<p>ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG</p>Degré de pureté :Min. 95%Notch 1 homolog antibody
<p>Notch 1 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 1 (NOTCH1) protein as the immunogen.</p>Degré de pureté :Min. 95%CYP7B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP7B1 antibody, catalog no. 70R-10195</p>Degré de pureté :Min. 95%FOLH1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FOLH1 antibody, catalog no. 70R-7150</p>Degré de pureté :Min. 95%Clostridium difficile Toxin A antibody
<p>Clostridium difficile Toxin A antibody is an active agent that specifically targets Clostridium difficile, a bacterium responsible for causing severe gastrointestinal infections. This antibody has a high affinity for the toxin produced by the bacteria and can effectively neutralize its harmful effects. The low density of this antibody allows for easy penetration into infected cells, where it can bind to and inhibit the activity of the toxin.</p>Glutamate receptor 2 antibody
<p>The Glutamate receptor 2 antibody is a highly specialized product in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody has shown promising results in targeting specific receptors, such as trastuzumab, fibrinogen, and alpha-fetoprotein.</p>TMEM59L antibody
<p>TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR</p>CHRNA5 antibody
<p>CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS</p>Galnt3 antibody
<p>Galnt3 antibody was raised in rabbit using the N terminal of Galnt3 as the immunogen</p>Degré de pureté :Min. 95%C3orf31 antibody
<p>C3orf31 antibody was raised in rabbit using the middle region of C3ORF31 as the immunogen</p>Degré de pureté :Min. 95%Pannexin 2 antibody
<p>Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA</p>PARP2 antibody
<p>The PARP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activity of the poly (ADP-ribose) polymerase 2 (PARP2) protein. This antibody has been extensively tested and validated for its specificity and efficacy.</p>SIGIRR Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGIRR antibody, catalog no. 70R-6630</p>Degré de pureté :Min. 95%SCG3 antibody
<p>The SCG3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), which is a transcription factor involved in various cellular processes. The SCG3 antibody has been shown to inhibit the polymerase activity of NF-κB, leading to a decrease in gene expression of acidic proteins. This antibody can be used in immunoassays to detect and quantify NF-κB activation. Additionally, the SCG3 antibody has proteolytic activity and has been shown to cleave caspase-9, an endonuclease involved in apoptosis. Its immobilization on surfaces allows for easy and efficient use in various experimental settings, making it a valuable tool for researchers studying NF-κB signaling pathways and related cellular processes.</p>Caspase 9 antibody
<p>The Caspase 9 antibody is a specific antibody used in pharmaceutical preparations and Life Sciences research. It is commonly used to detect and measure the levels of caspase-9, an enzyme involved in programmed cell death (apoptosis). This antibody recognizes the active form of caspase-9 and can be used for various applications such as Western blotting, immunohistochemistry, and flow cytometry.</p>EIF4G2 antibody
<p>The EIF4G2 antibody is a specific antibody that targets the growth factor EIF4G2. This antibody has been shown to bind to actin filaments and can be used for various applications, including immunohistochemistry and western blotting. Autoantibodies against EIF4G2 have also been detected in certain autoimmune diseases. The monoclonal form of this antibody exhibits cytotoxic activity, making it a valuable tool for research and therapeutic purposes. Additionally, the phosphatase activity of this antibody has been demonstrated in human serum samples. It is important to note that this antibody shows high affinity for serum albumin-binding, allowing for efficient detection and quantification in biological samples. Whether you are conducting experiments in life sciences or need reliable antibodies for your research, the EIF4G2 antibody is an excellent choice.</p>IL 17 Mouse
<p>IL 17 Mouse is a recombinant mouse monoclonal antibody that binds to the IL-17 receptor. It has been shown to activate the signal transduction pathway by binding to the IL-17 receptor and inducing activation of nuclear factor kappa B (NF-κB) and other signal transducers. This antibody is used as a research tool in cell biology, pharmacology, and immunology. IL 17 Mouse is a high purity product with an amino acid sequence identical to that of human IL-17 receptor, with no detectable contaminants.<br>!--</p>Degré de pureté :Min. 95%TEX9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TEX9 antibody, catalog no. 70R-3496</p>Degré de pureté :Min. 95%IL13 antibody (biotin)
<p>IL13 antibody (biotin) was raised in rabbit using highly pure recombinant hIL-13 as the immunogen.</p>SENP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SENP2 antibody, catalog no. 70R-3981</p>Degré de pureté :Min. 95%CTSG antibody
<p>CTSG antibody was raised in rabbit using the C terminal of CTSG as the immunogen</p>QSOX1 antibody
<p>The QSOX1 antibody is a monoclonal antibody that plays a crucial role in neutralizing the growth factor and steroid histidine. It is widely used in Life Sciences for its ability to target and bind to specific antigens, facilitating various research applications. This high-quality antibody is produced through hybridization techniques, ensuring its specificity and efficacy. The QSOX1 antibody has shown promising results in studies related to enzastaurin, dopamine, and natriuretic factors. It can also be utilized for the detection of autoantibodies and antigen-antibody reactions. With its exceptional binding capabilities, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.</p>MCM2 antibody
<p>The MCM2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets the MCM2 antigen, which plays a crucial role in DNA replication and cell cycle progression. This antibody can be used to detect and measure the levels of MCM2 in various biological samples, including adipose tissue, activated cells, and nuclear extracts.</p>Goat anti Human Kappa Chain (Texas Red)
<p>Goat anti-human kappa chain was raised in goat using human kappa light chain as the immunogen.</p>Degré de pureté :Min. 95%RBPMS antibody
<p>RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ</p>APP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APP antibody, catalog no. 70R-6196</p>Degré de pureté :Min. 95%ANKRD5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD5 antibody, catalog no. 70R-3379</p>Degré de pureté :Min. 95%GSK3B antibody
<p>The GSK3B antibody is a highly specific and potent monoclonal antibody that targets the fms-like tyrosine kinase 3 beta (GSK3B). It is designed to neutralize the activity of GSK3B, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the function of GSK3B.</p>FOXO4 antibody
<p>The FOXO4 antibody is a highly specialized substance that belongs to the group of antibodies. It is specifically designed to target and bind to the FOXO4 protein, which plays a crucial role in pluripotent stem cells. This antibody can be used in various research applications, including immunohistochemical staining and affinity ligand purification.</p>RNF212 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF212 antibody, catalog no. 70R-2823</p>Degré de pureté :Min. 95%Rabbit anti Dog IgG (H + L) (biotin)
<p>Rabbit anti-dog IgG (H+L) (biotin) was raised in rabbit using canine IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%FXYD5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FXYD5 antibody, catalog no. 70R-1682</p>Degré de pureté :Min. 95%ZNF664 antibody
<p>ZNF664 antibody was raised in rabbit using the N terminal of ZNF664 as the immunogen</p>Degré de pureté :Min. 95%HS2ST1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS2ST1 antibody, catalog no. 70R-5277</p>Degré de pureté :Min. 95%YBX1 antibody
<p>The YBX1 antibody is a highly specialized monoclonal antibody that targets the growth factor YBX1. It is designed for immobilization on electrodes and is commonly used in electrochemical impedance studies. This antibody has been extensively tested and proven to effectively detect and measure YBX1 levels in various samples, including human serum. It can also be used to detect autoantibodies against YBX1.</p>Goat anti Mouse IgG (H + L) (biotin)
<p>Goat anti-Mouse IgG (H + L) (biotin) was raised in goat using purified Mouse IgG (H&L) as the immunogen.</p>Degré de pureté :Min. 95%USP48 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of USP48 antibody, catalog no. 70R-6673</p>Degré de pureté :Min. 95%GRK5 antibody
<p>The GRK5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets and binds to the activated form of the GRK5 protein. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.</p>PPP2R5D Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5D antibody, catalog no. 70R-4534</p>Degré de pureté :Min. 95%FXR2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FXR2 antibody, catalog no. 70R-4723</p>Degré de pureté :Min. 95%Goat anti Mouse IgG (H + L) (FITC)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Degré de pureté :Min. 95%SLC25A36 antibody
<p>SLC25A36 antibody was raised using the N terminal of SLC25A36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG</p>Degré de pureté :Min. 95%Everolimus retroaldol degradation product
CAS :<p>Everolimus is a drug that is used in the treatment of certain cancers. It acts by binding to the cytosolic protein receptor known as the mammalian target of rapamycin (mTOR). This binding causes the inhibition of mTOR. Everolimus is converted by enzymes into a number of metabolites, including the retroaldol degradation product. The retroaldol degradation product has been shown to bind to ion channels and inhibit their activity. It is also a ligand for several receptors, such as the peptide growth hormone releasing factor (GHRF) receptor.</p>Formule :C53H83NO14Degré de pureté :Min. 95%Masse moléculaire :958.2 g/molRabbit anti Chicken IgG/Y (H + L) (FITC)
<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>Degré de pureté :Min. 95%PSME2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9402</p>Degré de pureté :Min. 95%Coronavirus Antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. This powerful compound is highly effective in treating tuberculosis infections. It works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its bactericidal activity has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>PRSS21 antibody
<p>PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen</p>Degré de pureté :Min. 95%LCK antibody
<p>The LCK antibody is a monoclonal antibody that targets LCK, a protein involved in T cell signaling. This antibody is commonly used in Life Sciences research to study immune responses and investigate the role of LCK in various cellular processes. It has been shown to be effective in blocking LCK activity, leading to decreased T cell activation and cytotoxicity. Additionally, the LCK antibody has potential therapeutic applications as it can be used to develop immunogenic compositions for the treatment of viral infections or autoimmune diseases. Its high specificity and affinity make it a valuable tool for scientists working in the field of immunology and drug discovery.</p>MKRN1 antibody
<p>MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW</p>HSP90AB1 antibody
<p>HSP90AB1 antibody was raised in rabbit using the C terminal of HSP90AB1 as the immunogen</p>Degré de pureté :Min. 95%Livin protein (His tag)
<p>1-298 amino acids: MGSSHHHHHH SSGLVPRGSH MGPKDSAKCL HRGPQPSHWA AGDGPTQERC GPRSLGSPVL GLDTCRAWDH VDGQILGQLR PLTEEEEEEG AGATLSRGPA FPGMGSEELR LASFYDWPLT AEVPPELLAA AGFFHTGHQD KVRCFFCYGG LQSWKRGDDP WTEHAKWFPS CQFLLRSKGR DFVHSVQETH SQLLGSWDPW EEPEDAAPVA PSVPASGYPE LPTPRREVQS ESAQEPGGVS PAEAQRAWWV LEPPGARDVE AQLRRLQEER TCKVCLDRAV SIVFVPCGHL VCAECAPGLQ LCPICRAPVR SRVRTFLS</p>Degré de pureté :Min. 95%IL13 antibody
<p>IL13 antibody was raised in rabbit using highly pure recombinant human IL-13 as the immunogen.</p>Degré de pureté :Min. 95%OTUD6A antibody
<p>OTUD6A antibody was raised in rabbit using the middle region of OTUD6A as the immunogen</p>Degré de pureté :Min. 95%
